Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   AAFV99_RS00830 Genome accession   NZ_CP151815
Coordinates   124331..124774 (-) Length   147 a.a.
NCBI ID   WP_001099009.1    Uniprot ID   A0A0C6EXF8
Organism   Staphylococcus aureus strain PS006-42     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 84640..134434 124331..124774 within 0


Gene organization within MGE regions


Location: 84640..134434
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AAFV99_RS00540 (AAFV99_00540) - 84640..85467 (-) 828 WP_000927632.1 sulfite exporter TauE/SafE family protein -
  AAFV99_RS00545 (AAFV99_00545) - 85480..86328 (-) 849 WP_000608129.1 DUF72 domain-containing protein -
  AAFV99_RS00550 (AAFV99_00550) - 86462..86560 (-) 99 WP_031835132.1 hypothetical protein -
  AAFV99_RS00555 (AAFV99_00555) - 86627..87694 (-) 1068 WP_000267249.1 nitronate monooxygenase family protein -
  AAFV99_RS00560 (AAFV99_00560) - 87708..88748 (-) 1041 WP_000582326.1 CNNM domain-containing protein -
  AAFV99_RS00565 (AAFV99_00565) - 89113..89427 (+) 315 WP_000274029.1 hypothetical protein -
  AAFV99_RS00570 (AAFV99_00570) - 89433..89570 (-) 138 WP_001790198.1 chorismate mutase -
  AAFV99_RS00575 (AAFV99_00575) eta 90102..90944 (-) 843 WP_001065781.1 exfoliative toxin A -
  AAFV99_RS00580 (AAFV99_00580) - 91070..92482 (-) 1413 WP_015984528.1 N-acetylmuramoyl-L-alanine amidase -
  AAFV99_RS00585 (AAFV99_00585) - 92469..92744 (-) 276 WP_000351119.1 phage holin -
  AAFV99_RS00590 (AAFV99_00590) - 92800..93195 (-) 396 WP_000398868.1 hypothetical protein -
  AAFV99_RS00595 (AAFV99_00595) - 93201..94439 (-) 1239 WP_015984527.1 BppU family phage baseplate upper protein -
  AAFV99_RS00600 (AAFV99_00600) - 94452..96326 (-) 1875 WP_015984526.1 glucosaminidase domain-containing protein -
  AAFV99_RS00605 (AAFV99_00605) - 96463..96762 (-) 300 WP_000466777.1 DUF2951 domain-containing protein -
  AAFV99_RS00610 (AAFV99_00610) - 96802..96975 (-) 174 WP_000782200.1 XkdX family protein -
  AAFV99_RS00615 (AAFV99_00615) - 96979..97356 (-) 378 WP_000705896.1 DUF2977 domain-containing protein -
  AAFV99_RS00620 (AAFV99_00620) - 97356..99179 (-) 1824 WP_015984525.1 phage baseplate upper protein -
  AAFV99_RS00625 (AAFV99_00625) - 99179..101077 (-) 1899 WP_015984524.1 hypothetical protein -
  AAFV99_RS00630 (AAFV99_00630) - 101090..102976 (-) 1887 WP_015984523.1 SGNH/GDSL hydrolase family protein -
  AAFV99_RS00635 (AAFV99_00635) - 102987..103928 (-) 942 WP_015984522.1 phage tail domain-containing protein -
  AAFV99_RS00640 (AAFV99_00640) - 103943..106828 (-) 2886 WP_015984521.1 hypothetical protein -
  AAFV99_RS00645 (AAFV99_00645) - 106832..107116 (-) 285 WP_000880587.1 hypothetical protein -
  AAFV99_RS00650 (AAFV99_00650) - 107161..107667 (-) 507 WP_000134337.1 tail assembly chaperone -
  AAFV99_RS00655 (AAFV99_00655) - 107734..108291 (-) 558 WP_000057582.1 tail protein -
  AAFV99_RS00660 (AAFV99_00660) - 108292..108717 (-) 426 WP_000270192.1 DUF3168 domain-containing protein -
  AAFV99_RS00665 (AAFV99_00665) - 108730..109143 (-) 414 WP_001151330.1 HK97-gp10 family putative phage morphogenesis protein -
  AAFV99_RS00670 (AAFV99_00670) - 109130..109465 (-) 336 WP_000483040.1 phage head closure protein -
  AAFV99_RS00675 (AAFV99_00675) - 109477..109827 (-) 351 WP_000177351.1 phage head-tail adapter protein -
  AAFV99_RS00680 (AAFV99_00680) - 109833..109976 (-) 144 WP_000002931.1 hypothetical protein -
  AAFV99_RS00685 (AAFV99_00685) - 109988..110902 (-) 915 WP_000235168.1 phage major capsid protein -
  AAFV99_RS00690 (AAFV99_00690) - 110919..111503 (-) 585 WP_001019221.1 DUF4355 domain-containing protein -
  AAFV99_RS00695 (AAFV99_00695) - 111606..111812 (-) 207 WP_000346032.1 hypothetical protein -
  AAFV99_RS00700 (AAFV99_00700) - 111814..112767 (-) 954 WP_015984520.1 phage head morphogenesis protein -
  AAFV99_RS00705 (AAFV99_00705) - 112736..114159 (-) 1424 Protein_110 phage portal protein -
  AAFV99_RS00710 (AAFV99_00710) - 114156..115379 (-) 1224 WP_001037578.1 PBSX family phage terminase large subunit -
  AAFV99_RS00715 (AAFV99_00715) - 115372..115866 (-) 495 WP_000594088.1 terminase small subunit -
  AAFV99_RS00720 (AAFV99_00720) - 116197..116619 (-) 423 WP_000162701.1 RinA family phage transcriptional activator -
  AAFV99_RS00725 (AAFV99_00725) - 116643..116789 (-) 147 WP_000990005.1 hypothetical protein -
  AAFV99_RS00730 (AAFV99_00730) - 116790..116963 (-) 174 WP_000595258.1 transcriptional activator RinB -
  AAFV99_RS00735 (AAFV99_00735) - 117010..117534 (-) 525 WP_015984519.1 hypothetical protein -
  AAFV99_RS00740 (AAFV99_00740) - 117534..117728 (-) 195 WP_015984518.1 DUF1381 domain-containing protein -
  AAFV99_RS00745 (AAFV99_00745) - 117765..118301 (-) 537 WP_015984517.1 dUTPase -
  AAFV99_RS00750 (AAFV99_00750) - 118294..118464 (-) 171 WP_000714413.1 hypothetical protein -
  AAFV99_RS00755 (AAFV99_00755) - 118451..118705 (-) 255 WP_017804684.1 DUF1024 family protein -
  AAFV99_RS00760 (AAFV99_00760) - 118698..119063 (-) 366 WP_001624703.1 hypothetical protein -
  AAFV99_RS00765 (AAFV99_00765) - 119060..119509 (-) 450 WP_000982708.1 YopX family protein -
  AAFV99_RS00770 (AAFV99_00770) - 119574..119816 (-) 243 WP_015984514.1 SAV1978 family virulence-associated passenger protein -
  AAFV99_RS00775 (AAFV99_00775) - 119820..120176 (-) 357 WP_000029376.1 SA1788 family PVL leukocidin-associated protein -
  AAFV99_RS00780 (AAFV99_00780) - 120304..120609 (-) 306 WP_000101252.1 hypothetical protein -
  AAFV99_RS00785 (AAFV99_00785) - 120610..120795 (-) 186 WP_001187243.1 DUF3113 family protein -
  AAFV99_RS00790 (AAFV99_00790) - 120800..121204 (-) 405 WP_000049794.1 DUF1064 domain-containing protein -
  AAFV99_RS00795 (AAFV99_00795) - 121214..121435 (-) 222 WP_015984512.1 DUF3269 family protein -
  AAFV99_RS00800 (AAFV99_00800) - 121448..121606 (-) 159 WP_000256589.1 hypothetical protein -
  AAFV99_RS00805 (AAFV99_00805) - 121600..122379 (-) 780 WP_367112090.1 ATP-binding protein -
  AAFV99_RS00810 (AAFV99_00810) - 122389..123159 (-) 771 WP_000190253.1 conserved phage C-terminal domain-containing protein -
  AAFV99_RS00815 (AAFV99_00815) - 123225..123506 (+) 282 WP_000414755.1 hypothetical protein -
  AAFV99_RS00820 (AAFV99_00820) - 123499..123648 (-) 150 WP_001081076.1 hypothetical protein -
  AAFV99_RS00825 (AAFV99_00825) - 123645..124319 (-) 675 WP_367112091.1 putative HNHc nuclease -
  AAFV99_RS00830 (AAFV99_00830) ssbA 124331..124774 (-) 444 WP_001099009.1 single-stranded DNA-binding protein Machinery gene
  AAFV99_RS00835 (AAFV99_00835) - 124771..125421 (-) 651 WP_000840496.1 ERF family protein -
  AAFV99_RS00840 (AAFV99_00840) - 125422..125958 (-) 537 WP_001004336.1 host-nuclease inhibitor Gam family protein -
  AAFV99_RS00845 (AAFV99_00845) - 125971..126231 (-) 261 WP_000291067.1 DUF1108 family protein -
  AAFV99_RS00850 (AAFV99_00850) - 126236..126538 (-) 303 WP_000165363.1 DUF2482 family protein -
  AAFV99_RS00855 (AAFV99_00855) - 126632..126793 (-) 162 WP_000066011.1 DUF1270 domain-containing protein -
  AAFV99_RS00860 (AAFV99_00860) - 126786..127007 (-) 222 WP_000977381.1 hypothetical protein -
  AAFV99_RS00865 (AAFV99_00865) - 127021..127470 (-) 450 WP_001094943.1 hypothetical protein -
  AAFV99_RS00870 (AAFV99_00870) - 127510..127734 (-) 225 WP_000187184.1 hypothetical protein -
  AAFV99_RS00875 (AAFV99_00875) - 127735..128502 (-) 768 WP_001002757.1 phage antirepressor Ant -
  AAFV99_RS00880 (AAFV99_00880) - 128502..128696 (-) 195 WP_000108122.1 helix-turn-helix transcriptional regulator -
  AAFV99_RS00885 (AAFV99_00885) - 128959..129291 (+) 333 WP_001055143.1 helix-turn-helix transcriptional regulator -
  AAFV99_RS00890 (AAFV99_00890) - 129308..129982 (+) 675 WP_000775187.1 ImmA/IrrE family metallo-endopeptidase -
  AAFV99_RS00895 (AAFV99_00895) - 130010..130735 (+) 726 WP_000661437.1 PH domain-containing protein -
  AAFV99_RS00900 (AAFV99_00900) - 130767..131672 (+) 906 WP_136625574.1 hypothetical protein -
  AAFV99_RS00905 (AAFV99_00905) - 131609..131809 (-) 201 WP_000143212.1 excisionase -
  AAFV99_RS00910 (AAFV99_00910) - 131920..132969 (+) 1050 WP_015984510.1 tyrosine-type recombinase/integrase -
  AAFV99_RS00915 (AAFV99_00915) sufB 133037..134434 (-) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -

Sequence


Protein


Download         Length: 147 a.a.        Molecular weight: 16321.89 Da        Isoelectric Point: 5.8347

>NTDB_id=980953 AAFV99_RS00830 WP_001099009.1 124331..124774(-) (ssbA) [Staphylococcus aureus strain PS006-42]
MNTVNLIGNLVADPELKGQNNNVVNFVIAVQRPFKNKQTNEYETDFIRCVAFGKTAEIIANNFNKGNKIGVTGSIQTGSY
ENNQGQKVFTTDIAVNNITFVERKNNGQSNNQQQHNSYNAPQNRQQSNNPFANANGPIEISDDDLPF

Nucleotide


Download         Length: 444 bp        

>NTDB_id=980953 AAFV99_RS00830 WP_001099009.1 124331..124774(-) (ssbA) [Staphylococcus aureus strain PS006-42]
ATGAATACAGTAAATTTAATTGGGAACCTAGTGGCAGATCCAGAGTTAAAAGGTCAAAACAACAACGTAGTTAACTTTGT
AATCGCAGTACAGAGACCATTCAAAAACAAACAAACTAACGAATATGAAACAGACTTCATTCGTTGTGTTGCATTTGGTA
AGACTGCTGAAATCATCGCTAATAACTTTAATAAAGGTAATAAAATTGGCGTTACTGGTTCAATACAAACCGGTAGTTAT
GAAAATAATCAAGGACAGAAAGTGTTTACTACAGACATCGCAGTCAACAATATAACTTTCGTTGAACGTAAAAACAACGG
TCAATCTAACAACCAACAACAGCATAATTCATATAACGCACCACAGAATAGACAGCAATCAAATAATCCATTTGCTAATG
CTAATGGTCCTATAGAAATCTCTGACGATGATTTACCTTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0C6EXF8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

41.279

100

0.483

  ssb Latilactobacillus sakei subsp. sakei 23K

38.235

100

0.442


Multiple sequence alignment