Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   AADZ70_RS10475 Genome accession   NZ_CP151679
Coordinates   2099210..2099350 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus sp. YBsi01     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2094210..2104350
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AADZ70_RS10450 (AADZ70_10450) - 2094550..2094933 (-) 384 WP_049627263.1 hotdog fold thioesterase -
  AADZ70_RS10455 (AADZ70_10455) comA 2094955..2095599 (-) 645 WP_016938117.1 response regulator transcription factor Regulator
  AADZ70_RS10460 (AADZ70_10460) comP 2095680..2097971 (-) 2292 WP_016938116.1 histidine kinase Regulator
  AADZ70_RS10465 (AADZ70_10465) comX 2097983..2098147 (-) 165 WP_007613432.1 competence pheromone ComX -
  AADZ70_RS10470 (AADZ70_10470) - 2098147..2099058 (-) 912 WP_029575319.1 polyprenyl synthetase family protein -
  AADZ70_RS10475 (AADZ70_10475) degQ 2099210..2099350 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  AADZ70_RS10480 (AADZ70_10480) - 2099816..2100157 (+) 342 WP_045925849.1 hypothetical protein -
  AADZ70_RS10485 (AADZ70_10485) - 2100162..2101385 (-) 1224 WP_342007004.1 EAL and HDOD domain-containing protein -
  AADZ70_RS10490 (AADZ70_10490) - 2101515..2102981 (-) 1467 WP_095241408.1 nicotinate phosphoribosyltransferase -
  AADZ70_RS10495 (AADZ70_10495) - 2102999..2103550 (-) 552 WP_016938111.1 isochorismatase family cysteine hydrolase -
  AADZ70_RS10500 (AADZ70_10500) - 2103639..2104037 (-) 399 WP_342007005.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=979700 AADZ70_RS10475 WP_013353398.1 2099210..2099350(-) (degQ) [Bacillus sp. YBsi01]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=979700 AADZ70_RS10475 WP_013353398.1 2099210..2099350(-) (degQ) [Bacillus sp. YBsi01]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCTTTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913

Multiple sequence alignment