Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WA044_RS14805 Genome accession   NZ_CP151554
Coordinates   3003926..3004066 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain E69     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2998926..3009066
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WA044_RS14780 (WA044_14780) - 2999223..2999606 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  WA044_RS14785 (WA044_14785) comA 2999628..3000272 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  WA044_RS14790 (WA044_14790) comP 3000353..3002656 (-) 2304 WP_003152050.1 histidine kinase Regulator
  WA044_RS14795 (WA044_14795) comX 3002676..3002855 (-) 180 WP_306383677.1 competence pheromone ComX -
  WA044_RS14800 (WA044_14800) comQ 3002809..3003795 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  WA044_RS14805 (WA044_14805) degQ 3003926..3004066 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  WA044_RS14810 (WA044_14810) - 3004532..3004873 (+) 342 WP_014305721.1 hypothetical protein -
  WA044_RS14815 (WA044_14815) - 3004880..3006100 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  WA044_RS14820 (WA044_14820) - 3006230..3007696 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  WA044_RS14825 (WA044_14825) - 3007714..3008265 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  WA044_RS14830 (WA044_14830) - 3008362..3008760 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=979143 WA044_RS14805 WP_003152043.1 3003926..3004066(-) (degQ) [Bacillus velezensis strain E69]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=979143 WA044_RS14805 WP_003152043.1 3003926..3004066(-) (degQ) [Bacillus velezensis strain E69]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment