Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | ACAM21_RS02900 | Genome accession | NZ_AP031395 |
| Coordinates | 542065..542214 (+) | Length | 49 a.a. |
| NCBI ID | WP_001820573.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 16P29 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 537065..547214
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACAM21_RS02850 (SPNE16P29_05580) | comA/nlmT | 537105..537692 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| ACAM21_RS02855 (SPNE16P29_05590) | blpI | 537974..538171 (+) | 198 | WP_001093261.1 | bacteriocin-like peptide BlpI | - |
| ACAM21_RS02860 (SPNE16P29_05610) | blpJ | 538638..538907 (+) | 270 | WP_001093248.1 | bacteriocin-like peptide BlpJ | - |
| ACAM21_RS02865 (SPNE16P29_05620) | blpU | 538976..539206 (+) | 231 | WP_000379967.1 | bacteriocin-like peptide BlpU | - |
| ACAM21_RS02870 | - | 539209..539328 (+) | 120 | WP_000346298.1 | PncF family bacteriocin immunity protein | - |
| ACAM21_RS02875 (SPNE16P29_05630) | - | 539625..539789 (+) | 165 | WP_000727118.1 | hypothetical protein | - |
| ACAM21_RS02880 (SPNE16P29_05640) | - | 539786..540190 (+) | 405 | WP_000846944.1 | hypothetical protein | - |
| ACAM21_RS02885 | - | 540393..541198 (+) | 806 | Protein_568 | IS5 family transposase | - |
| ACAM21_RS02890 (SPNE16P29_05670) | blpM | 541348..541602 (+) | 255 | WP_000379877.1 | two-peptide bacteriocin subunit BlpM | - |
| ACAM21_RS02895 (SPNE16P29_05680) | blpN | 541618..541821 (+) | 204 | WP_001099492.1 | two-peptide bacteriocin subunit BlpN | - |
| ACAM21_RS02900 (SPNE16P29_05690) | cipB | 542065..542214 (+) | 150 | WP_001820573.1 | bacteriocin-like peptide BlpO | Regulator |
| ACAM21_RS02905 | - | 542318..542437 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| ACAM21_RS02910 (SPNE16P29_05710) | - | 543223..543606 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| ACAM21_RS02915 (SPNE16P29_05720) | - | 543658..544347 (+) | 690 | WP_000760510.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ACAM21_RS02920 (SPNE16P29_05730) | blpZ | 544389..544622 (+) | 234 | WP_001818347.1 | immunity protein BlpZ | - |
| ACAM21_RS02925 | - | 544773..545384 (+) | 612 | WP_000394049.1 | CPBP family intramembrane glutamic endopeptidase | - |
| ACAM21_RS02930 (SPNE16P29_05740) | ccrZ | 545545..546339 (+) | 795 | WP_000363002.1 | cell cycle regulator CcrZ | - |
| ACAM21_RS02935 (SPNE16P29_05750) | trmB | 546336..546971 (+) | 636 | WP_369608084.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5150.91 Da Isoelectric Point: 3.9133
>NTDB_id=97783 ACAM21_RS02900 WP_001820573.1 542065..542214(+) (cipB) [Streptococcus pneumoniae strain 16P29]
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MDTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=97783 ACAM21_RS02900 WP_001820573.1 542065..542214(+) (cipB) [Streptococcus pneumoniae strain 16P29]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
51.02 |
100 |
0.51 |