Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R8619_RS02530 Genome accession   NZ_AP026918
Coordinates   485658..485807 (+) Length   49 a.a.
NCBI ID   WP_001813641.1    Uniprot ID   A0A6I3TPS6
Organism   Streptococcus pneumoniae strain PZ900700009     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 483986..484791 485658..485807 flank 867


Gene organization within MGE regions


Location: 483986..485807
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8619_RS02515 - 483986..484791 (+) 806 Protein_494 IS5 family transposase -
  R8619_RS02520 (PC0009_04900) blpM 484941..485195 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  R8619_RS02525 (PC0009_04910) blpN 485211..485414 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R8619_RS02530 (PC0009_04920) cipB 485658..485807 (+) 150 WP_001813641.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5164.93 Da        Isoelectric Point: 3.9133

>NTDB_id=97782 R8619_RS02530 WP_001813641.1 485658..485807(+) (cipB) [Streptococcus pneumoniae strain PZ900700009]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCTAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=97782 R8619_RS02530 WP_001813641.1 485658..485807(+) (cipB) [Streptococcus pneumoniae strain PZ900700009]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTACAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-41)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A6I3TPS6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

48.98

100

0.49

Multiple sequence alignment