Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MGAS37854_RS05285 | Genome accession | NZ_CP151444 |
| Coordinates | 1037675..1038100 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS37854 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1002416..1048726 | 1037675..1038100 | within | 0 |
Gene organization within MGE regions
Location: 1002416..1048726
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS37854_RS05040 (MGAS37854_02076) | pfkA | 1002416..1003429 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS37854_RS05045 (MGAS37854_02078) | - | 1003509..1006619 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS37854_RS05050 (MGAS37854_02080) | - | 1006804..1007175 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS37854_RS05055 (MGAS37854_02082) | - | 1007175..1007873 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS37854_RS05060 (MGAS37854_02084) | - | 1007883..1008668 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS37854_RS05065 (MGAS37854_02086) | - | 1008795..1009409 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS37854_RS05075 (MGAS37854_02090) | prx | 1010000..1010188 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS37854_RS05080 (MGAS37854_02092) | speA | 1010408..1011163 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS37854_RS05085 (MGAS37854_02094) | - | 1011285..1011944 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS37854_RS05090 (MGAS37854_02096) | - | 1011944..1012165 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS37854_RS05095 (MGAS37854_02098) | - | 1012175..1012948 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS37854_RS05100 (MGAS37854_02100) | - | 1012959..1013561 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS37854_RS05105 (MGAS37854_02102) | - | 1013573..1014337 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS37854_RS05110 (MGAS37854_02104) | - | 1014339..1014671 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS37854_RS05115 (MGAS37854_02106) | - | 1014671..1014994 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS37854_RS05120 (MGAS37854_02108) | - | 1015008..1015130 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS37854_RS05125 (MGAS37854_02110) | - | 1015144..1015491 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS37854_RS05130 (MGAS37854_02112) | - | 1015502..1017364 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS37854_RS05135 (MGAS37854_02114) | - | 1017369..1020809 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS37854_RS05140 (MGAS37854_02116) | - | 1020810..1022294 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS37854_RS05145 (MGAS37854_02118) | - | 1022295..1024100 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS37854_RS05150 (MGAS37854_02120) | - | 1024093..1024551 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS37854_RS05155 (MGAS37854_02122) | - | 1024524..1024841 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS37854_RS05160 (MGAS37854_02124) | - | 1024854..1025360 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS37854_RS05165 (MGAS37854_02126) | - | 1025372..1025782 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS37854_RS05170 (MGAS37854_02128) | - | 1025784..1026179 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS37854_RS05175 (MGAS37854_02130) | - | 1026176..1026487 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS37854_RS05180 (MGAS37854_02132) | - | 1026484..1026828 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS37854_RS05185 (MGAS37854_02134) | - | 1026842..1027135 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS37854_RS05190 (MGAS37854_02136) | - | 1027148..1028038 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS37854_RS05195 (MGAS37854_02138) | - | 1028057..1028626 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS37854_RS05200 (MGAS37854_02140) | - | 1028735..1028869 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS37854_RS05205 (MGAS37854_02142) | - | 1028871..1029140 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS37854_RS05210 (MGAS37854_02144) | - | 1029147..1030055 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS37854_RS05215 (MGAS37854_02146) | - | 1030024..1031349 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS37854_RS05220 (MGAS37854_02148) | - | 1031349..1032623 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS37854_RS05225 (MGAS37854_02150) | - | 1032613..1032993 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS37854_RS05230 (MGAS37854_02152) | - | 1033603..1034037 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS37854_RS05235 (MGAS37854_02154) | - | 1034323..1034589 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS37854_RS05240 (MGAS37854_02156) | - | 1034586..1035110 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS37854_RS05245 (MGAS37854_02158) | - | 1035113..1035745 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS37854_RS05250 (MGAS37854_02160) | - | 1035747..1036031 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS37854_RS05255 (MGAS37854_02162) | - | 1036028..1036198 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS37854_RS05260 (MGAS37854_02164) | - | 1036195..1036431 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS37854_RS05265 (MGAS37854_02166) | - | 1036431..1036676 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS37854_RS05270 (MGAS37854_02168) | - | 1036673..1037029 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS37854_RS05275 (MGAS37854_02170) | - | 1037026..1037466 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS37854_RS05280 | - | 1037466..1037669 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS37854_RS05285 (MGAS37854_02172) | ssb | 1037675..1038100 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS37854_RS05290 (MGAS37854_02174) | - | 1038093..1038767 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS37854_RS05295 (MGAS37854_02176) | - | 1038768..1039250 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS37854_RS05300 (MGAS37854_02178) | - | 1039272..1039526 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS37854_RS05305 (MGAS37854_02180) | - | 1039507..1039860 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS37854_RS05310 (MGAS37854_02184) | - | 1040001..1040783 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS37854_RS05315 (MGAS37854_02186) | - | 1040770..1041600 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS37854_RS05320 | - | 1041614..1041802 (-) | 189 | Protein_999 | XRE family transcriptional regulator | - |
| MGAS37854_RS05325 | - | 1042036..1042275 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS37854_RS05330 (MGAS37854_02190) | - | 1042406..1042615 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS37854_RS05335 (MGAS37854_02192) | - | 1042725..1042925 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| MGAS37854_RS05340 (MGAS37854_02194) | - | 1042999..1043385 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS37854_RS05345 (MGAS37854_02196) | - | 1043374..1043583 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS37854_RS05350 (MGAS37854_02198) | - | 1043637..1044236 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS37854_RS05355 (MGAS37854_02200) | - | 1044266..1044424 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS37854_RS05360 (MGAS37854_02204) | - | 1044781..1045605 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS37854_RS05365 (MGAS37854_02206) | - | 1045641..1046534 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS37854_RS05370 (MGAS37854_02210) | - | 1046655..1047743 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS37854_RS05375 (MGAS37854_02212) | - | 1048106..1048726 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=977154 MGAS37854_RS05285 WP_011285575.1 1037675..1038100(-) (ssb) [Streptococcus pyogenes strain MGAS37854]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=977154 MGAS37854_RS05285 WP_011285575.1 1037675..1038100(-) (ssb) [Streptococcus pyogenes strain MGAS37854]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |