Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   R8563_RS02535 Genome accession   NZ_AP026917
Coordinates   491986..492135 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain PZ900700007     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 490315..491119 491986..492135 flank 867


Gene organization within MGE regions


Location: 490315..492135
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  R8563_RS02520 - 490315..491119 (+) 805 WP_151394153.1 IS5 family transposase -
  R8563_RS02525 (PC0007_04880) blpM 491269..491523 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  R8563_RS02530 (PC0007_04890) blpN 491539..491742 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  R8563_RS02535 (PC0007_04900) cipB 491986..492135 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=97705 R8563_RS02535 WP_001818346.1 491986..492135(+) (cipB) [Streptococcus pneumoniae strain PZ900700007]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=97705 R8563_RS02535 WP_001818346.1 491986..492135(+) (cipB) [Streptococcus pneumoniae strain PZ900700007]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51

Multiple sequence alignment