Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACK2OW_RS06780 Genome accession   NZ_CP180575
Coordinates   1216515..1216655 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain K3C     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 1211515..1221655
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACK2OW_RS06755 (ACK2OW_06755) yuxO 1211828..1212208 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  ACK2OW_RS06760 (ACK2OW_06760) comA 1212227..1212871 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACK2OW_RS06765 (ACK2OW_06765) comP 1212952..1215258 (-) 2307 WP_021480496.1 two-component system sensor histidine kinase ComP Regulator
  ACK2OW_RS06770 (ACK2OW_06770) comX 1215275..1215448 (-) 174 WP_021480497.1 competence pheromone ComX Regulator
  ACK2OW_RS06775 (ACK2OW_06775) comQ 1215464..1216330 (-) 867 WP_021480498.1 polyprenyl synthetase family protein Regulator
  ACK2OW_RS06780 (ACK2OW_06780) degQ 1216515..1216655 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACK2OW_RS06785 (ACK2OW_06785) - 1216877..1216939 (+) 63 Protein_1343 hypothetical protein -
  ACK2OW_RS06790 (ACK2OW_06790) - 1217117..1217485 (+) 369 WP_021480499.1 hypothetical protein -
  ACK2OW_RS06795 (ACK2OW_06795) pdeH 1217461..1218690 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACK2OW_RS06800 (ACK2OW_06800) pncB 1218827..1220299 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACK2OW_RS06805 (ACK2OW_06805) pncA 1220315..1220866 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  ACK2OW_RS06810 (ACK2OW_06810) yueI 1220963..1221361 (-) 399 WP_095252562.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=974986 ACK2OW_RS06780 WP_003220708.1 1216515..1216655(-) (degQ) [Bacillus subtilis strain K3C]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=974986 ACK2OW_RS06780 WP_003220708.1 1216515..1216655(-) (degQ) [Bacillus subtilis strain K3C]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment