Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACMX77_RS17330 Genome accession   NZ_CP180438
Coordinates   3275091..3275231 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain W-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3270091..3280231
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACMX77_RS17305 (ACMX77_17305) yuxO 3270434..3270814 (-) 381 WP_174616601.1 hotdog fold thioesterase -
  ACMX77_RS17310 (ACMX77_17310) comA 3270832..3271476 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACMX77_RS17315 (ACMX77_17315) comP 3271557..3273857 (-) 2301 WP_415749590.1 histidine kinase Regulator
  ACMX77_RS17320 (ACMX77_17320) comX 3273869..3274033 (-) 165 WP_015384519.1 competence pheromone ComX -
  ACMX77_RS17325 (ACMX77_17325) comQ 3274046..3274906 (-) 861 WP_015483633.1 polyprenyl synthetase family protein Regulator
  ACMX77_RS17330 (ACMX77_17330) degQ 3275091..3275231 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACMX77_RS17335 (ACMX77_17335) - 3275453..3275578 (+) 126 WP_154796978.1 hypothetical protein -
  ACMX77_RS17340 (ACMX77_17340) - 3275692..3276060 (+) 369 WP_015483634.1 hypothetical protein -
  ACMX77_RS17345 (ACMX77_17345) pdeH 3276036..3277265 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ACMX77_RS17350 (ACMX77_17350) pncB 3277402..3278874 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACMX77_RS17355 (ACMX77_17355) pncA 3278890..3279441 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  ACMX77_RS17360 (ACMX77_17360) yueI 3279538..3279936 (-) 399 WP_014477837.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=974762 ACMX77_RS17330 WP_003220708.1 3275091..3275231(-) (degQ) [Bacillus subtilis strain W-2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=974762 ACMX77_RS17330 WP_003220708.1 3275091..3275231(-) (degQ) [Bacillus subtilis strain W-2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1