Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   ACL6EQ_RS15490 Genome accession   NZ_CP178716
Coordinates   2981638..2981778 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SY1483     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2976638..2986778
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACL6EQ_RS15465 (ACL6EQ_15465) yuxO 2976914..2977294 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  ACL6EQ_RS15470 (ACL6EQ_15470) comA 2977313..2977957 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ACL6EQ_RS15475 (ACL6EQ_15475) comP 2978038..2980350 (-) 2313 WP_099085219.1 histidine kinase Regulator
  ACL6EQ_RS15480 (ACL6EQ_15480) comX 2980366..2980587 (-) 222 WP_014114983.1 competence pheromone ComX -
  ACL6EQ_RS15485 (ACL6EQ_15485) comQ 2980584..2981453 (-) 870 WP_015714626.1 polyprenyl synthetase family protein Regulator
  ACL6EQ_RS15490 (ACL6EQ_15490) degQ 2981638..2981778 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ACL6EQ_RS15495 (ACL6EQ_15495) - 2982000..2982062 (+) 63 Protein_3012 hypothetical protein -
  ACL6EQ_RS15500 (ACL6EQ_15500) - 2982240..2982608 (+) 369 WP_327826230.1 hypothetical protein -
  ACL6EQ_RS15505 (ACL6EQ_15505) pdeH 2982584..2983813 (-) 1230 WP_024572553.1 cyclic di-GMP phosphodiesterase -
  ACL6EQ_RS15510 (ACL6EQ_15510) pncB 2983950..2985422 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ACL6EQ_RS15515 (ACL6EQ_15515) pncA 2985438..2985989 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  ACL6EQ_RS15520 (ACL6EQ_15520) yueI 2986086..2986484 (-) 399 WP_014480710.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=972890 ACL6EQ_RS15490 WP_003220708.1 2981638..2981778(-) (degQ) [Bacillus subtilis strain SY1483]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=972890 ACL6EQ_RS15490 WP_003220708.1 2981638..2981778(-) (degQ) [Bacillus subtilis strain SY1483]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1