Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MHB78_RS09775 Genome accession   NZ_CP150286
Coordinates   1813329..1813505 (-) Length   58 a.a.
NCBI ID   WP_046129962.1    Uniprot ID   A0A0J6E1Q0
Organism   Bacillus sp. FSL K6-0138     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1808329..1818505
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB78_RS09730 (MHB78_09730) comGE 1808631..1808978 (+) 348 WP_046129970.1 competence type IV pilus minor pilin ComGE -
  MHB78_RS09735 (MHB78_09735) comGF 1808893..1809378 (+) 486 WP_082094061.1 competence type IV pilus minor pilin ComGF -
  MHB78_RS09740 (MHB78_09740) comGG 1809390..1809755 (+) 366 WP_046129969.1 competence type IV pilus minor pilin ComGG -
  MHB78_RS09745 (MHB78_09745) - 1809837..1810019 (+) 183 WP_046129968.1 YqzE family protein -
  MHB78_RS09750 (MHB78_09750) - 1810104..1810427 (-) 324 WP_046129967.1 DUF3889 domain-containing protein -
  MHB78_RS09755 (MHB78_09755) tapA 1810690..1811415 (+) 726 WP_046129966.1 amyloid fiber anchoring/assembly protein TapA -
  MHB78_RS09760 (MHB78_09760) - 1811412..1811993 (+) 582 WP_046129965.1 signal peptidase I -
  MHB78_RS09765 (MHB78_09765) - 1812062..1812856 (+) 795 WP_046129964.1 TasA family protein -
  MHB78_RS09770 (MHB78_09770) sinR 1812960..1813295 (-) 336 WP_096891855.1 transcriptional regulator SinR Regulator
  MHB78_RS09775 (MHB78_09775) sinI 1813329..1813505 (-) 177 WP_046129962.1 anti-repressor SinI family protein Regulator
  MHB78_RS09780 (MHB78_09780) - 1813691..1814485 (-) 795 WP_046129961.1 YqhG family protein -
  MHB78_RS09785 (MHB78_09785) - 1814489..1816156 (-) 1668 WP_046129960.1 SNF2-related protein -
  MHB78_RS09790 (MHB78_09790) gcvT 1816736..1817830 (+) 1095 WP_046129959.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6708.47 Da        Isoelectric Point: 4.4545

>NTDB_id=969547 MHB78_RS09775 WP_046129962.1 1813329..1813505(-) (sinI) [Bacillus sp. FSL K6-0138]
MNKVEHEKEELDKEWEELIKSALNEGISPEEIRIFLNLGNKTSEASTPIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=969547 MHB78_RS09775 WP_046129962.1 1813329..1813505(-) (sinI) [Bacillus sp. FSL K6-0138]
ATGAATAAAGTGGAACATGAGAAAGAAGAATTGGACAAGGAGTGGGAAGAGCTGATCAAAAGTGCTCTCAATGAAGGCAT
TAGTCCGGAAGAAATAAGAATATTTCTCAATTTAGGAAATAAGACTTCCGAAGCTTCCACACCAATTGAAAGAAGTCATT
CAATAAATCCCTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A0J6E1Q0

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5


Multiple sequence alignment