Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MHH79_RS12670 Genome accession   NZ_CP150275
Coordinates   2445424..2445597 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL K6-0993     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2440424..2450597
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHH79_RS12655 (MHH79_12655) gcvT 2441223..2442311 (-) 1089 WP_063335289.1 glycine cleavage system aminomethyltransferase GcvT -
  MHH79_RS12660 (MHH79_12660) - 2442753..2444426 (+) 1674 WP_047182869.1 SNF2-related protein -
  MHH79_RS12665 (MHH79_12665) - 2444447..2445241 (+) 795 WP_003230200.1 YqhG family protein -
  MHH79_RS12670 (MHH79_12670) sinI 2445424..2445597 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MHH79_RS12675 (MHH79_12675) sinR 2445631..2445966 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MHH79_RS12680 (MHH79_12680) tasA 2446059..2446844 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  MHH79_RS12685 (MHH79_12685) - 2446908..2447480 (-) 573 WP_080030740.1 signal peptidase I -
  MHH79_RS12690 (MHH79_12690) tapA 2447464..2448225 (-) 762 WP_063335290.1 amyloid fiber anchoring/assembly protein TapA -
  MHH79_RS12695 (MHH79_12695) - 2448495..2448821 (+) 327 WP_047183570.1 YqzG/YhdC family protein -
  MHH79_RS12700 (MHH79_12700) - 2448863..2449042 (-) 180 WP_003230176.1 YqzE family protein -
  MHH79_RS12705 (MHH79_12705) comGG 2449114..2449488 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MHH79_RS12710 (MHH79_12710) comGF 2449489..2449872 (-) 384 WP_063335292.1 ComG operon protein ComGF Machinery gene
  MHH79_RS12715 (MHH79_12715) comGE 2449898..2450245 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=969109 MHH79_RS12670 WP_003230187.1 2445424..2445597(+) (sinI) [Bacillus sp. FSL K6-0993]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=969109 MHH79_RS12670 WP_003230187.1 2445424..2445597(+) (sinI) [Bacillus sp. FSL K6-0993]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment