Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MHI44_RS06615 Genome accession   NZ_CP150268
Coordinates   1230528..1230668 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL K6-1366     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1225528..1235668
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHI44_RS06590 (MHI44_06590) - 1225878..1226258 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  MHI44_RS06595 (MHI44_06595) comA 1226277..1226921 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MHI44_RS06600 (MHI44_06600) comP 1227002..1229299 (-) 2298 WP_033884760.1 histidine kinase Regulator
  MHI44_RS06605 (MHI44_06605) comX 1229307..1229468 (-) 162 WP_003241045.1 competence pheromone ComX -
  MHI44_RS06610 (MHI44_06610) - 1229483..1230343 (-) 861 WP_192857944.1 polyprenyl synthetase family protein -
  MHI44_RS06615 (MHI44_06615) degQ 1230528..1230668 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MHI44_RS06620 (MHI44_06620) - 1230890..1230952 (+) 63 Protein_1292 hypothetical protein -
  MHI44_RS06625 (MHI44_06625) - 1231131..1231499 (+) 369 WP_017695529.1 hypothetical protein -
  MHI44_RS06630 (MHI44_06630) pdeH 1231475..1232704 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  MHI44_RS06635 (MHI44_06635) - 1232841..1234313 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MHI44_RS06640 (MHI44_06640) - 1234329..1234880 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  MHI44_RS06645 (MHI44_06645) - 1234977..1235375 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=968810 MHI44_RS06615 WP_003220708.1 1230528..1230668(-) (degQ) [Bacillus sp. FSL K6-1366]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=968810 MHI44_RS06615 WP_003220708.1 1230528..1230668(-) (degQ) [Bacillus sp. FSL K6-1366]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment