Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKX80_RS17445 Genome accession   NZ_CP150260
Coordinates   3417464..3417604 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus sp. FSL K6-0972     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3412464..3422604
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX80_RS17420 (MKX80_17420) - 3412777..3413166 (-) 390 WP_154999191.1 hotdog fold thioesterase -
  MKX80_RS17425 (MKX80_17425) comA 3413183..3413821 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  MKX80_RS17430 (MKX80_17430) comP 3413908..3416214 (-) 2307 WP_234112223.1 ATP-binding protein Regulator
  MKX80_RS17435 (MKX80_17435) comX 3416216..3416389 (-) 174 WP_234112224.1 competence pheromone ComX -
  MKX80_RS17440 (MKX80_17440) - 3416393..3417274 (-) 882 WP_268332708.1 polyprenyl synthetase family protein -
  MKX80_RS17445 (MKX80_17445) degQ 3417464..3417604 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  MKX80_RS17450 (MKX80_17450) - 3418090..3418437 (+) 348 WP_268343102.1 hypothetical protein -
  MKX80_RS17455 (MKX80_17455) - 3418479..3419699 (-) 1221 WP_182070139.1 HDOD domain-containing protein -
  MKX80_RS17460 (MKX80_17460) - 3419879..3421348 (-) 1470 WP_154999184.1 nicotinate phosphoribosyltransferase -
  MKX80_RS17465 (MKX80_17465) - 3421366..3421917 (-) 552 WP_154999183.1 isochorismatase family cysteine hydrolase -
  MKX80_RS17470 (MKX80_17470) - 3422100..3422501 (-) 402 WP_025809741.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=968478 MKX80_RS17445 WP_003184860.1 3417464..3417604(-) (degQ) [Bacillus sp. FSL K6-0972]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=968478 MKX80_RS17445 WP_003184860.1 3417464..3417604(-) (degQ) [Bacillus sp. FSL K6-0972]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652

Multiple sequence alignment