Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKX38_RS16140 Genome accession   NZ_CP150258
Coordinates   3104150..3104290 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL M8-0025     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3099150..3109290
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX38_RS16115 (MKX38_16115) - 3099500..3099880 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  MKX38_RS16120 (MKX38_16120) comA 3099899..3100543 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MKX38_RS16125 (MKX38_16125) comP 3100624..3102921 (-) 2298 WP_339187702.1 histidine kinase Regulator
  MKX38_RS16130 (MKX38_16130) comX 3102929..3103090 (-) 162 WP_003241045.1 competence pheromone ComX -
  MKX38_RS16135 (MKX38_16135) - 3103105..3103965 (-) 861 WP_032677058.1 polyprenyl synthetase family protein -
  MKX38_RS16140 (MKX38_16140) degQ 3104150..3104290 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MKX38_RS16145 (MKX38_16145) - 3104512..3104574 (+) 63 Protein_3113 hypothetical protein -
  MKX38_RS16150 (MKX38_16150) - 3104753..3105121 (+) 369 WP_017695529.1 hypothetical protein -
  MKX38_RS16155 (MKX38_16155) pdeH 3105097..3106326 (-) 1230 WP_339187704.1 cyclic di-GMP phosphodiesterase -
  MKX38_RS16160 (MKX38_16160) - 3106463..3107935 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MKX38_RS16165 (MKX38_16165) - 3107951..3108502 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  MKX38_RS16170 (MKX38_16170) - 3108599..3108997 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=968332 MKX38_RS16140 WP_003220708.1 3104150..3104290(-) (degQ) [Bacillus sp. FSL M8-0025]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=968332 MKX38_RS16140 WP_003220708.1 3104150..3104290(-) (degQ) [Bacillus sp. FSL M8-0025]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment