Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   MKY56_RS16390 Genome accession   NZ_CP150257
Coordinates   3133590..3133730 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL M8-0054     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3128590..3138730
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY56_RS16365 (MKY56_16365) - 3128867..3129247 (-) 381 WP_326253860.1 hotdog fold thioesterase -
  MKY56_RS16370 (MKY56_16370) comA 3129266..3129910 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MKY56_RS16375 (MKY56_16375) comP 3129991..3132303 (-) 2313 WP_032722435.1 histidine kinase Regulator
  MKY56_RS16380 (MKY56_16380) comX 3132319..3132540 (-) 222 WP_014480704.1 competence pheromone ComX -
  MKY56_RS16385 (MKY56_16385) - 3132542..3133405 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  MKY56_RS16390 (MKY56_16390) degQ 3133590..3133730 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MKY56_RS16395 (MKY56_16395) - 3133952..3134077 (+) 126 WP_003228793.1 hypothetical protein -
  MKY56_RS16400 (MKY56_16400) - 3134192..3134560 (+) 369 WP_046381300.1 hypothetical protein -
  MKY56_RS16405 (MKY56_16405) pdeH 3134536..3135765 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  MKY56_RS16410 (MKY56_16410) - 3135902..3137374 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MKY56_RS16415 (MKY56_16415) - 3137390..3137941 (-) 552 WP_326253862.1 isochorismatase family cysteine hydrolase -
  MKY56_RS16420 (MKY56_16420) - 3138038..3138436 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=968253 MKY56_RS16390 WP_003220708.1 3133590..3133730(-) (degQ) [Bacillus sp. FSL M8-0054]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=968253 MKY56_RS16390 WP_003220708.1 3133590..3133730(-) (degQ) [Bacillus sp. FSL M8-0054]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment