Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKX71_RS16310 Genome accession   NZ_CP150256
Coordinates   3133292..3133432 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL M8-0071     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3128292..3138432
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX71_RS16285 (MKX71_16285) - 3128642..3129022 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  MKX71_RS16290 (MKX71_16290) comA 3129041..3129685 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  MKX71_RS16295 (MKX71_16295) comP 3129766..3132063 (-) 2298 WP_130572792.1 histidine kinase Regulator
  MKX71_RS16300 (MKX71_16300) comX 3132071..3132232 (-) 162 WP_003241045.1 competence pheromone ComX -
  MKX71_RS16305 (MKX71_16305) - 3132247..3133107 (-) 861 WP_174222604.1 polyprenyl synthetase family protein -
  MKX71_RS16310 (MKX71_16310) degQ 3133292..3133432 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  MKX71_RS16315 (MKX71_16315) - 3133654..3133716 (+) 63 Protein_3147 hypothetical protein -
  MKX71_RS16320 (MKX71_16320) - 3133894..3134262 (+) 369 WP_212129296.1 hypothetical protein -
  MKX71_RS16325 (MKX71_16325) pdeH 3134238..3135467 (-) 1230 WP_212129295.1 EAL and HDOD domain-containing protein -
  MKX71_RS16330 (MKX71_16330) - 3135604..3137076 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  MKX71_RS16335 (MKX71_16335) - 3137092..3137643 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  MKX71_RS16340 (MKX71_16340) - 3137740..3138138 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=968174 MKX71_RS16310 WP_003220708.1 3133292..3133432(-) (degQ) [Bacillus sp. FSL M8-0071]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=968174 MKX71_RS16310 WP_003220708.1 3133292..3133432(-) (degQ) [Bacillus sp. FSL M8-0071]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment