Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKZ05_RS14555 Genome accession   NZ_CP150255
Coordinates   2862802..2862942 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL M8-0277     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2857802..2867942
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKZ05_RS14530 (MKZ05_14530) - 2858067..2858456 (-) 390 WP_106066313.1 hotdog fold thioesterase -
  MKZ05_RS14535 (MKZ05_14535) comA 2858480..2859121 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  MKZ05_RS14540 (MKZ05_14540) comP 2859202..2861514 (-) 2313 WP_212045488.1 ATP-binding protein Regulator
  MKZ05_RS14545 (MKZ05_14545) comX 2861569..2861739 (-) 171 WP_212045489.1 competence pheromone ComX -
  MKZ05_RS14550 (MKZ05_14550) - 2861736..2862650 (-) 915 WP_212045490.1 polyprenyl synthetase family protein -
  MKZ05_RS14555 (MKZ05_14555) degQ 2862802..2862942 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MKZ05_RS14560 (MKZ05_14560) - 2863448..2863801 (+) 354 WP_212045491.1 inner spore coat protein -
  MKZ05_RS14565 (MKZ05_14565) - 2863832..2865058 (-) 1227 WP_212045764.1 HDOD domain-containing protein -
  MKZ05_RS14570 (MKZ05_14570) - 2865199..2866668 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  MKZ05_RS14575 (MKZ05_14575) - 2866686..2867237 (-) 552 WP_212045492.1 isochorismatase family cysteine hydrolase -
  MKZ05_RS14580 (MKZ05_14580) - 2867298..2867705 (-) 408 WP_050944045.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=968097 MKZ05_RS14555 WP_003213123.1 2862802..2862942(-) (degQ) [Bacillus sp. FSL M8-0277]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=968097 MKZ05_RS14555 WP_003213123.1 2862802..2862942(-) (degQ) [Bacillus sp. FSL M8-0277]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment