Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MKY10_RS09405 Genome accession   NZ_CP150253
Coordinates   1760553..1760927 (+) Length   124 a.a.
NCBI ID   WP_015251714.1    Uniprot ID   -
Organism   Bacillus sp. FSL P4-0290     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1755553..1765927
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY10_RS09365 (MKY10_09365) corA 1755622..1756575 (+) 954 WP_015483432.1 magnesium transporter CorA -
  MKY10_RS09370 (MKY10_09370) - 1756577..1756774 (+) 198 WP_014480259.1 CBS domain-containing protein -
  MKY10_RS09375 (MKY10_09375) comGA 1756987..1758057 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MKY10_RS09380 (MKY10_09380) comGB 1758044..1759081 (+) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  MKY10_RS09385 (MKY10_09385) comGC 1759095..1759391 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MKY10_RS09390 (MKY10_09390) comGD 1759381..1759812 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  MKY10_RS09395 (MKY10_09395) comGE 1759796..1760143 (+) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  MKY10_RS09400 (MKY10_09400) comGF 1760169..1760552 (+) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  MKY10_RS09405 (MKY10_09405) comGG 1760553..1760927 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  MKY10_RS09410 (MKY10_09410) - 1760998..1761177 (+) 180 WP_029726723.1 YqzE family protein -
  MKY10_RS09415 (MKY10_09415) - 1761219..1761545 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKY10_RS09420 (MKY10_09420) tapA 1761817..1762578 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  MKY10_RS09425 (MKY10_09425) - 1762562..1763134 (+) 573 WP_003246088.1 signal peptidase I -
  MKY10_RS09430 (MKY10_09430) tasA 1763198..1763983 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  MKY10_RS09435 (MKY10_09435) sinR 1764076..1764411 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKY10_RS09440 (MKY10_09440) sinI 1764445..1764618 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKY10_RS09445 (MKY10_09445) - 1764801..1765595 (-) 795 WP_003230200.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14540.73 Da        Isoelectric Point: 8.7849

>NTDB_id=967965 MKY10_RS09405 WP_015251714.1 1760553..1760927(+) (comGG) [Bacillus sp. FSL P4-0290]
MYRTRGFIYPAVLFVSALVLLIVNFTAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=967965 MKY10_RS09405 WP_015251714.1 1760553..1760927(+) (comGG) [Bacillus sp. FSL P4-0290]
ATGTACCGTACGAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTACTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATCGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGACCAAAAACAGAAAAAGCTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

96.774

100

0.968

Multiple sequence alignment