Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NYE20_RS13505 Genome accession   NZ_CP150252
Coordinates   2550695..2550868 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus sp. FSL R5-0416     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2545695..2555868
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE20_RS13490 (NYE20_13490) gcvT 2546493..2547581 (-) 1089 WP_049141217.1 glycine cleavage system aminomethyltransferase GcvT -
  NYE20_RS13495 (NYE20_13495) - 2548023..2549696 (+) 1674 WP_032726152.1 SNF2-related protein -
  NYE20_RS13500 (NYE20_13500) - 2549717..2550511 (+) 795 WP_032726154.1 YqhG family protein -
  NYE20_RS13505 (NYE20_13505) sinI 2550695..2550868 (+) 174 WP_014477323.1 anti-repressor SinI family protein Regulator
  NYE20_RS13510 (NYE20_13510) sinR 2550902..2551237 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NYE20_RS13515 (NYE20_13515) tasA 2551329..2552114 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  NYE20_RS13520 (NYE20_13520) - 2552179..2552751 (-) 573 WP_003246088.1 signal peptidase I -
  NYE20_RS13525 (NYE20_13525) tapA 2552735..2553496 (-) 762 WP_032726156.1 amyloid fiber anchoring/assembly protein TapA -
  NYE20_RS13530 (NYE20_13530) - 2553767..2554093 (+) 327 WP_038829733.1 YqzG/YhdC family protein -
  NYE20_RS13535 (NYE20_13535) - 2554135..2554314 (-) 180 WP_014480252.1 YqzE family protein -
  NYE20_RS13540 (NYE20_13540) comGG 2554386..2554760 (-) 375 WP_032726157.1 ComG operon protein ComGG Machinery gene
  NYE20_RS13545 (NYE20_13545) comGF 2554761..2555144 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NYE20_RS13550 (NYE20_13550) comGE 2555170..2555517 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=967881 NYE20_RS13505 WP_014477323.1 2550695..2550868(+) (sinI) [Bacillus sp. FSL R5-0416]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=967881 NYE20_RS13505 WP_014477323.1 2550695..2550868(+) (sinI) [Bacillus sp. FSL R5-0416]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982

Multiple sequence alignment