Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NYE53_RS15905 Genome accession   NZ_CP150251
Coordinates   3088187..3088327 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL R5-0523     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3083187..3093327
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE53_RS15880 (NYE53_15880) - 3083464..3083844 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  NYE53_RS15885 (NYE53_15885) comA 3083863..3084507 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NYE53_RS15890 (NYE53_15890) comP 3084588..3086900 (-) 2313 WP_339245592.1 histidine kinase Regulator
  NYE53_RS15895 (NYE53_15895) comX 3086916..3087137 (-) 222 WP_014480704.1 competence pheromone ComX -
  NYE53_RS15900 (NYE53_15900) - 3087139..3088002 (-) 864 WP_339245595.1 polyprenyl synthetase family protein -
  NYE53_RS15905 (NYE53_15905) degQ 3088187..3088327 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NYE53_RS15910 (NYE53_15910) - 3088549..3088611 (+) 63 Protein_3066 hypothetical protein -
  NYE53_RS15915 (NYE53_15915) - 3088789..3089157 (+) 369 WP_339245597.1 hypothetical protein -
  NYE53_RS15920 (NYE53_15920) pdeH 3089133..3090362 (-) 1230 WP_133954407.1 cyclic di-GMP phosphodiesterase -
  NYE53_RS15925 (NYE53_15925) - 3090499..3091971 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NYE53_RS15930 (NYE53_15930) - 3091987..3092538 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  NYE53_RS15935 (NYE53_15935) - 3092635..3093033 (-) 399 WP_014477837.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=967825 NYE53_RS15905 WP_003220708.1 3088187..3088327(-) (degQ) [Bacillus sp. FSL R5-0523]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=967825 NYE53_RS15905 WP_003220708.1 3088187..3088327(-) (degQ) [Bacillus sp. FSL R5-0523]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment