Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MKY61_RS14655 Genome accession   NZ_CP150247
Coordinates   2775031..2775207 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus sp. FSL M8-0315     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2770031..2780207
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY61_RS14640 (MKY61_14640) gcvT 2770673..2771767 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  MKY61_RS14645 (MKY61_14645) - 2772360..2774039 (+) 1680 WP_003183439.1 SNF2-related protein -
  MKY61_RS14650 (MKY61_14650) - 2774046..2774840 (+) 795 WP_003183441.1 YqhG family protein -
  MKY61_RS14655 (MKY61_14655) sinI 2775031..2775207 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  MKY61_RS14660 (MKY61_14660) sinR 2775241..2775576 (+) 336 WP_006637528.1 helix-turn-helix domain-containing protein Regulator
  MKY61_RS14665 (MKY61_14665) - 2775681..2776475 (-) 795 WP_003183447.1 TasA family protein -
  MKY61_RS14670 (MKY61_14670) - 2776549..2777133 (-) 585 WP_003183449.1 signal peptidase I -
  MKY61_RS14675 (MKY61_14675) tapA 2777130..2777858 (-) 729 WP_011198112.1 amyloid fiber anchoring/assembly protein TapA -
  MKY61_RS14680 (MKY61_14680) - 2778168..2778455 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  MKY61_RS14685 (MKY61_14685) - 2778485..2778667 (-) 183 WP_003183456.1 YqzE family protein -
  MKY61_RS14690 (MKY61_14690) comGG 2778756..2779121 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  MKY61_RS14695 (MKY61_14695) comGF 2779134..2779622 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  MKY61_RS14700 (MKY61_14700) comGE 2779531..2779878 (-) 348 WP_026699160.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=967585 MKY61_RS14655 WP_003183444.1 2775031..2775207(+) (sinI) [Bacillus sp. FSL M8-0315]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=967585 MKY61_RS14655 WP_003183444.1 2775031..2775207(+) (sinI) [Bacillus sp. FSL M8-0315]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment