Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MKY62_RS13045 Genome accession   NZ_CP150217
Coordinates   2522419..2522595 (+) Length   58 a.a.
NCBI ID   WP_003183444.1    Uniprot ID   -
Organism   Bacillus sp. FSL R7-0646     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2517419..2527595
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY62_RS13030 (MKY62_13030) gcvT 2518061..2519155 (-) 1095 WP_003183436.1 glycine cleavage system aminomethyltransferase GcvT -
  MKY62_RS13035 (MKY62_13035) - 2519748..2521427 (+) 1680 WP_003183439.1 SNF2-related protein -
  MKY62_RS13040 (MKY62_13040) - 2521434..2522228 (+) 795 WP_003183441.1 YqhG family protein -
  MKY62_RS13045 (MKY62_13045) sinI 2522419..2522595 (+) 177 WP_003183444.1 anti-repressor SinI family protein Regulator
  MKY62_RS13050 (MKY62_13050) sinR 2522629..2522964 (+) 336 WP_025804940.1 helix-turn-helix domain-containing protein Regulator
  MKY62_RS13055 (MKY62_13055) - 2523069..2523863 (-) 795 WP_003183447.1 TasA family protein -
  MKY62_RS13060 (MKY62_13060) - 2523937..2524521 (-) 585 WP_003183449.1 signal peptidase I -
  MKY62_RS13065 (MKY62_13065) tapA 2524518..2525246 (-) 729 WP_003183451.1 amyloid fiber anchoring/assembly protein TapA -
  MKY62_RS13070 (MKY62_13070) - 2525556..2525843 (+) 288 WP_223307118.1 YqzG/YhdC family protein -
  MKY62_RS13075 (MKY62_13075) - 2525867..2526049 (-) 183 WP_003183456.1 YqzE family protein -
  MKY62_RS13080 (MKY62_13080) comGG 2526138..2526503 (-) 366 WP_003183459.1 competence type IV pilus minor pilin ComGG -
  MKY62_RS13085 (MKY62_13085) comGF 2526516..2527004 (-) 489 WP_011201694.1 competence type IV pilus minor pilin ComGF -
  MKY62_RS13090 (MKY62_13090) comGE 2526913..2527260 (-) 348 WP_009327907.1 competence type IV pilus minor pilin ComGE -

Sequence

Protein


Download         Length: 58 a.a.        Molecular weight: 6724.47 Da        Isoelectric Point: 4.7616

>NTDB_id=966663 MKY62_RS13045 WP_003183444.1 2522419..2522595(+) (sinI) [Bacillus sp. FSL R7-0646]
MNKDKNEKEELDEEWTDLIKHALEQGISPEEIRIFLNLGKKSSNPSTSIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=966663 MKY62_RS13045 WP_003183444.1 2522419..2522595(+) (sinI) [Bacillus sp. FSL R7-0646]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGACTTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGAAATACGTATTTTTCTCAATTTGGGAAAGAAGTCTTCAAATCCTTCCACATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

51.724

100

0.517

Multiple sequence alignment