Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NST06_RS15590 Genome accession   NZ_CP150197
Coordinates   2965848..2965988 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL P4-0322     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2960848..2970988
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST06_RS15565 (NST06_15565) - 2961170..2961559 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NST06_RS15570 (NST06_15570) comA 2961583..2962224 (-) 642 WP_024423322.1 response regulator transcription factor Regulator
  NST06_RS15575 (NST06_15575) comP 2962305..2964611 (-) 2307 WP_339240207.1 ATP-binding protein Regulator
  NST06_RS15580 (NST06_15580) comX 2964625..2964795 (-) 171 WP_012011107.1 competence pheromone ComX -
  NST06_RS15585 (NST06_15585) - 2964773..2965696 (-) 924 WP_339240210.1 polyprenyl synthetase family protein -
  NST06_RS15590 (NST06_15590) degQ 2965848..2965988 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NST06_RS15595 (NST06_15595) - 2966494..2966850 (+) 357 WP_024425946.1 hypothetical protein -
  NST06_RS15600 (NST06_15600) - 2966886..2968112 (-) 1227 WP_339241688.1 HDOD domain-containing protein -
  NST06_RS15605 (NST06_15605) - 2968250..2969722 (-) 1473 WP_024423327.1 nicotinate phosphoribosyltransferase -
  NST06_RS15610 (NST06_15610) - 2969740..2970291 (-) 552 WP_171464645.1 isochorismatase family cysteine hydrolase -
  NST06_RS15615 (NST06_15615) - 2970352..2970759 (-) 408 WP_024423329.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=965994 NST06_RS15590 WP_003213123.1 2965848..2965988(-) (degQ) [Bacillus sp. FSL P4-0322]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=965994 NST06_RS15590 WP_003213123.1 2965848..2965988(-) (degQ) [Bacillus sp. FSL P4-0322]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696


Multiple sequence alignment