Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ42_RS16380 Genome accession   NZ_CP150184
Coordinates   3132728..3132868 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL W8-0812     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3127728..3137868
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ42_RS16355 (NSQ42_16355) - 3128000..3128380 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  NSQ42_RS16360 (NSQ42_16360) comA 3128399..3129043 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSQ42_RS16365 (NSQ42_16365) - 3129124..3131441 (-) 2318 Protein_3157 histidine kinase -
  NSQ42_RS16370 (NSQ42_16370) comX 3131457..3131678 (-) 222 WP_014480704.1 competence pheromone ComX -
  NSQ42_RS16375 (NSQ42_16375) - 3131680..3132543 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  NSQ42_RS16380 (NSQ42_16380) degQ 3132728..3132868 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSQ42_RS16385 (NSQ42_16385) - 3133090..3133215 (+) 126 WP_003228793.1 hypothetical protein -
  NSQ42_RS16390 (NSQ42_16390) - 3133329..3133697 (+) 369 WP_014477834.1 hypothetical protein -
  NSQ42_RS16395 (NSQ42_16395) pdeH 3133673..3134902 (-) 1230 WP_339225597.1 cyclic di-GMP phosphodiesterase -
  NSQ42_RS16400 (NSQ42_16400) - 3135039..3136511 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NSQ42_RS16405 (NSQ42_16405) - 3136527..3137078 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  NSQ42_RS16410 (NSQ42_16410) - 3137175..3137573 (-) 399 WP_088467369.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=965385 NSQ42_RS16380 WP_003220708.1 3132728..3132868(-) (degQ) [Bacillus sp. FSL W8-0812]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=965385 NSQ42_RS16380 WP_003220708.1 3132728..3132868(-) (degQ) [Bacillus sp. FSL W8-0812]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment