Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NSU05_RS16000 Genome accession   NZ_CP150177
Coordinates   3104512..3104652 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. EU52     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3099512..3109652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSU05_RS15975 (NSU05_15975) - 3099789..3100169 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NSU05_RS15980 (NSU05_15980) comA 3100188..3100832 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSU05_RS15985 (NSU05_15985) comP 3100913..3103225 (-) 2313 WP_032722435.1 histidine kinase Regulator
  NSU05_RS15990 (NSU05_15990) comX 3103241..3103462 (-) 222 WP_014480704.1 competence pheromone ComX -
  NSU05_RS15995 (NSU05_15995) - 3103464..3104327 (-) 864 WP_032722437.1 polyprenyl synthetase family protein -
  NSU05_RS16000 (NSU05_16000) degQ 3104512..3104652 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSU05_RS16005 (NSU05_16005) - 3104874..3104999 (+) 126 WP_003228793.1 hypothetical protein -
  NSU05_RS16010 (NSU05_16010) - 3105113..3105481 (+) 369 WP_014477834.1 hypothetical protein -
  NSU05_RS16015 (NSU05_16015) pdeH 3105457..3106686 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NSU05_RS16020 (NSU05_16020) - 3106823..3108295 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NSU05_RS16025 (NSU05_16025) - 3108311..3108862 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  NSU05_RS16030 (NSU05_16030) - 3108959..3109357 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=965108 NSU05_RS16000 WP_003220708.1 3104512..3104652(-) (degQ) [Bacillus sp. EU52]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=965108 NSU05_RS16000 WP_003220708.1 3104512..3104652(-) (degQ) [Bacillus sp. EU52]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment