Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ12_RS16880 Genome accession   NZ_CP150160
Coordinates   3218447..3218587 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. PS95     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3213447..3223587
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ12_RS16855 (NSQ12_16855) - 3213789..3214169 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  NSQ12_RS16860 (NSQ12_16860) comA 3214188..3214832 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSQ12_RS16865 (NSQ12_16865) comP 3214913..3217213 (-) 2301 WP_088300729.1 histidine kinase Regulator
  NSQ12_RS16870 (NSQ12_16870) comX 3217225..3217389 (-) 165 WP_015384519.1 competence pheromone ComX -
  NSQ12_RS16875 (NSQ12_16875) - 3217402..3218262 (-) 861 WP_339175206.1 polyprenyl synthetase family protein -
  NSQ12_RS16880 (NSQ12_16880) degQ 3218447..3218587 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSQ12_RS16885 (NSQ12_16885) - 3218809..3218934 (+) 126 WP_121549029.1 hypothetical protein -
  NSQ12_RS16890 (NSQ12_16890) - 3219049..3219417 (+) 369 WP_326146021.1 hypothetical protein -
  NSQ12_RS16895 (NSQ12_16895) pdeH 3219393..3220622 (-) 1230 WP_128738183.1 cyclic di-GMP phosphodiesterase -
  NSQ12_RS16900 (NSQ12_16900) - 3220759..3222231 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NSQ12_RS16905 (NSQ12_16905) - 3222247..3222798 (-) 552 WP_339175209.1 isochorismatase family cysteine hydrolase -
  NSQ12_RS16910 (NSQ12_16910) - 3222895..3223293 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=964093 NSQ12_RS16880 WP_003220708.1 3218447..3218587(-) (degQ) [Bacillus sp. PS95]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=964093 NSQ12_RS16880 WP_003220708.1 3218447..3218587(-) (degQ) [Bacillus sp. PS95]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment