Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NSQ12_RS12625 Genome accession   NZ_CP150160
Coordinates   2460764..2460937 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS95     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2455764..2465937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ12_RS12610 (NSQ12_12610) gcvT 2456563..2457651 (-) 1089 WP_213379484.1 glycine cleavage system aminomethyltransferase GcvT -
  NSQ12_RS12615 (NSQ12_12615) - 2458093..2459766 (+) 1674 WP_213379486.1 SNF2-related protein -
  NSQ12_RS12620 (NSQ12_12620) - 2459787..2460581 (+) 795 WP_003230200.1 YqhG family protein -
  NSQ12_RS12625 (NSQ12_12625) sinI 2460764..2460937 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ12_RS12630 (NSQ12_12630) sinR 2460971..2461306 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ12_RS12635 (NSQ12_12635) tasA 2461399..2462184 (-) 786 WP_015714250.1 biofilm matrix protein TasA -
  NSQ12_RS12640 (NSQ12_12640) - 2462248..2462820 (-) 573 WP_003230181.1 signal peptidase I -
  NSQ12_RS12645 (NSQ12_12645) tapA 2462804..2463565 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ12_RS12650 (NSQ12_12650) - 2463837..2464163 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ12_RS12655 (NSQ12_12655) - 2464205..2464384 (-) 180 WP_072175549.1 YqzE family protein -
  NSQ12_RS12660 (NSQ12_12660) comGG 2464455..2464829 (-) 375 WP_167408283.1 ComG operon protein ComGG Machinery gene
  NSQ12_RS12665 (NSQ12_12665) comGF 2464830..2465213 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NSQ12_RS12670 (NSQ12_12670) comGE 2465239..2465586 (-) 348 WP_167408284.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=964069 NSQ12_RS12625 WP_003230187.1 2460764..2460937(+) (sinI) [Bacillus sp. PS95]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=964069 NSQ12_RS12625 WP_003230187.1 2460764..2460937(+) (sinI) [Bacillus sp. PS95]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment