Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NST79_RS16545 Genome accession   NZ_CP150159
Coordinates   3166154..3166294 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. PS196     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3161154..3171294
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST79_RS16520 (NST79_16520) - 3161431..3161811 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  NST79_RS16525 (NST79_16525) comA 3161830..3162474 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NST79_RS16530 (NST79_16530) comP 3162555..3164867 (-) 2313 WP_198878535.1 histidine kinase Regulator
  NST79_RS16535 (NST79_16535) comX 3164883..3165104 (-) 222 WP_014480704.1 competence pheromone ComX -
  NST79_RS16540 (NST79_16540) - 3165106..3165969 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  NST79_RS16545 (NST79_16545) degQ 3166154..3166294 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NST79_RS16550 (NST79_16550) - 3166515..3166640 (+) 126 WP_003228793.1 hypothetical protein -
  NST79_RS16555 (NST79_16555) - 3166754..3167122 (+) 369 WP_014477834.1 hypothetical protein -
  NST79_RS16560 (NST79_16560) pdeH 3167098..3168327 (-) 1230 WP_212059044.1 EAL and HDOD domain-containing protein -
  NST79_RS16565 (NST79_16565) - 3168464..3169936 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NST79_RS16570 (NST79_16570) - 3169952..3170503 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  NST79_RS16575 (NST79_16575) - 3170600..3170998 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=964013 NST79_RS16545 WP_003220708.1 3166154..3166294(-) (degQ) [Bacillus sp. PS196]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=964013 NST79_RS16545 WP_003220708.1 3166154..3166294(-) (degQ) [Bacillus sp. PS196]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1