Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NSQ21_RS12505 Genome accession   NZ_CP150158
Coordinates   2444582..2444755 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS210     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2439582..2449755
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ21_RS12490 (NSQ21_12490) gcvT 2440381..2441469 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  NSQ21_RS12495 (NSQ21_12495) - 2441911..2443584 (+) 1674 WP_003230203.1 SNF2-related protein -
  NSQ21_RS12500 (NSQ21_12500) - 2443605..2444399 (+) 795 WP_003230200.1 YqhG family protein -
  NSQ21_RS12505 (NSQ21_12505) sinI 2444582..2444755 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ21_RS12510 (NSQ21_12510) sinR 2444789..2445124 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ21_RS12515 (NSQ21_12515) tasA 2445217..2446002 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NSQ21_RS12520 (NSQ21_12520) - 2446066..2446638 (-) 573 WP_003230181.1 signal peptidase I -
  NSQ21_RS12525 (NSQ21_12525) tapA 2446622..2447383 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ21_RS12530 (NSQ21_12530) - 2447655..2447981 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ21_RS12535 (NSQ21_12535) - 2448023..2448202 (-) 180 WP_003230176.1 YqzE family protein -
  NSQ21_RS12540 (NSQ21_12540) comGG 2448273..2448647 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NSQ21_RS12545 (NSQ21_12545) comGF 2448648..2449031 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NSQ21_RS12550 (NSQ21_12550) comGE 2449057..2449404 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=963910 NSQ21_RS12505 WP_003230187.1 2444582..2444755(+) (sinI) [Bacillus sp. PS210]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=963910 NSQ21_RS12505 WP_003230187.1 2444582..2444755(+) (sinI) [Bacillus sp. PS210]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1