Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   NSQ83_RS16775 Genome accession   NZ_CP150157
Coordinates   3214395..3214535 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. PS217     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3209395..3219535
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ83_RS16750 (NSQ83_16750) - 3209672..3210052 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  NSQ83_RS16755 (NSQ83_16755) comA 3210071..3210715 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSQ83_RS16760 (NSQ83_16760) comP 3210796..3213108 (-) 2313 WP_077671126.1 histidine kinase Regulator
  NSQ83_RS16765 (NSQ83_16765) comX 3213124..3213345 (-) 222 WP_014480704.1 competence pheromone ComX -
  NSQ83_RS16770 (NSQ83_16770) - 3213347..3214210 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  NSQ83_RS16775 (NSQ83_16775) degQ 3214395..3214535 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSQ83_RS16780 (NSQ83_16780) - 3214757..3214882 (+) 126 WP_121549029.1 hypothetical protein -
  NSQ83_RS16785 (NSQ83_16785) - 3214997..3215365 (+) 369 WP_038427878.1 hypothetical protein -
  NSQ83_RS16790 (NSQ83_16790) pdeH 3215341..3216570 (-) 1230 WP_339238693.1 cyclic di-GMP phosphodiesterase -
  NSQ83_RS16795 (NSQ83_16795) - 3216707..3218179 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NSQ83_RS16800 (NSQ83_16800) - 3218195..3218746 (-) 552 WP_014477836.1 isochorismatase family cysteine hydrolase -
  NSQ83_RS16805 (NSQ83_16805) - 3218843..3219241 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=963851 NSQ83_RS16775 WP_003220708.1 3214395..3214535(-) (degQ) [Bacillus sp. PS217]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=963851 NSQ83_RS16775 WP_003220708.1 3214395..3214535(-) (degQ) [Bacillus sp. PS217]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1