Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   NST22_RS16600 Genome accession   NZ_CP150156
Coordinates   3182572..3182739 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus sp. PS237     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3177572..3187739
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST22_RS16570 (NST22_16570) - 3177967..3178443 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  NST22_RS16575 (NST22_16575) - 3178443..3178727 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  NST22_RS16580 (NST22_16580) mnhG 3178711..3179085 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  NST22_RS16585 (NST22_16585) - 3179124..3179504 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NST22_RS16590 (NST22_16590) comA 3179523..3180167 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NST22_RS16595 (NST22_16595) comP 3180248..3182557 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  NST22_RS16600 (NST22_16600) comX 3182572..3182739 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NST22_RS16605 (NST22_16605) comQ 3182727..3183626 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NST22_RS16610 (NST22_16610) degQ 3183811..3183951 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NST22_RS16615 (NST22_16615) - 3184173..3184298 (+) 126 WP_003228793.1 hypothetical protein -
  NST22_RS16620 (NST22_16620) - 3184412..3184780 (+) 369 WP_003243784.1 hypothetical protein -
  NST22_RS16625 (NST22_16625) pdeH 3184756..3185985 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NST22_RS16630 (NST22_16630) - 3186122..3187594 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=963770 NST22_RS16600 WP_003242801.1 3182572..3182739(-) (comX) [Bacillus sp. PS237]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=963770 NST22_RS16600 WP_003242801.1 3182572..3182739(-) (comX) [Bacillus sp. PS237]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1