Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NST22_RS12480 Genome accession   NZ_CP150156
Coordinates   2440260..2440433 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS237     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2435260..2445433
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST22_RS12465 (NST22_12465) gcvT 2436059..2437147 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  NST22_RS12470 (NST22_12470) - 2437589..2439262 (+) 1674 WP_003230203.1 SNF2-related protein -
  NST22_RS12475 (NST22_12475) - 2439283..2440077 (+) 795 WP_003230200.1 YqhG family protein -
  NST22_RS12480 (NST22_12480) sinI 2440260..2440433 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NST22_RS12485 (NST22_12485) sinR 2440467..2440802 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NST22_RS12490 (NST22_12490) tasA 2440895..2441680 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NST22_RS12495 (NST22_12495) - 2441744..2442316 (-) 573 WP_003230181.1 signal peptidase I -
  NST22_RS12500 (NST22_12500) tapA 2442300..2443061 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NST22_RS12505 (NST22_12505) - 2443333..2443659 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NST22_RS12510 (NST22_12510) - 2443701..2443880 (-) 180 WP_003230176.1 YqzE family protein -
  NST22_RS12515 (NST22_12515) comGG 2443951..2444325 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NST22_RS12520 (NST22_12520) comGF 2444326..2444709 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NST22_RS12525 (NST22_12525) comGE 2444735..2445082 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=963746 NST22_RS12480 WP_003230187.1 2440260..2440433(+) (sinI) [Bacillus sp. PS237]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=963746 NST22_RS12480 WP_003230187.1 2440260..2440433(+) (sinI) [Bacillus sp. PS237]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1