Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ16_RS16465 Genome accession   NZ_CP150155
Coordinates   3154577..3154717 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. PS108     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3149577..3159717
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ16_RS16440 (NSQ16_16440) - 3149919..3150299 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  NSQ16_RS16445 (NSQ16_16445) comA 3150318..3150962 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSQ16_RS16450 (NSQ16_16450) comP 3151043..3153343 (-) 2301 WP_088300729.1 histidine kinase Regulator
  NSQ16_RS16455 (NSQ16_16455) comX 3153355..3153519 (-) 165 WP_015384519.1 competence pheromone ComX -
  NSQ16_RS16460 (NSQ16_16460) - 3153532..3154392 (-) 861 WP_128422373.1 polyprenyl synthetase family protein -
  NSQ16_RS16465 (NSQ16_16465) degQ 3154577..3154717 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSQ16_RS16470 (NSQ16_16470) - 3154939..3155064 (+) 126 WP_144500545.1 hypothetical protein -
  NSQ16_RS16475 (NSQ16_16475) - 3155178..3155546 (+) 369 WP_144500544.1 hypothetical protein -
  NSQ16_RS16480 (NSQ16_16480) pdeH 3155522..3156751 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NSQ16_RS16485 (NSQ16_16485) - 3156888..3158360 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NSQ16_RS16490 (NSQ16_16490) - 3158376..3158927 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  NSQ16_RS16495 (NSQ16_16495) - 3159024..3159422 (-) 399 WP_085185940.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=963687 NSQ16_RS16465 WP_003220708.1 3154577..3154717(-) (degQ) [Bacillus sp. PS108]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=963687 NSQ16_RS16465 WP_003220708.1 3154577..3154717(-) (degQ) [Bacillus sp. PS108]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1