Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NSQ16_RS12325 Genome accession   NZ_CP150155
Coordinates   2405289..2405462 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS108     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2400289..2410462
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ16_RS12310 (NSQ16_12310) gcvT 2401088..2402176 (-) 1089 WP_042976496.1 glycine cleavage system aminomethyltransferase GcvT -
  NSQ16_RS12315 (NSQ16_12315) - 2402618..2404291 (+) 1674 WP_153529794.1 SNF2-related protein -
  NSQ16_RS12320 (NSQ16_12320) - 2404312..2405106 (+) 795 WP_003230200.1 YqhG family protein -
  NSQ16_RS12325 (NSQ16_12325) sinI 2405289..2405462 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ16_RS12330 (NSQ16_12330) sinR 2405496..2405831 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ16_RS12335 (NSQ16_12335) tasA 2405924..2406709 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NSQ16_RS12340 (NSQ16_12340) - 2406773..2407345 (-) 573 WP_003230181.1 signal peptidase I -
  NSQ16_RS12345 (NSQ16_12345) tapA 2407329..2408090 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ16_RS12350 (NSQ16_12350) - 2408362..2408688 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ16_RS12355 (NSQ16_12355) - 2408730..2408909 (-) 180 WP_003230176.1 YqzE family protein -
  NSQ16_RS12360 (NSQ16_12360) comGG 2408980..2409354 (-) 375 WP_273796674.1 ComG operon protein ComGG Machinery gene
  NSQ16_RS12365 (NSQ16_12365) comGF 2409355..2409738 (-) 384 WP_076458111.1 ComG operon protein ComGF Machinery gene
  NSQ16_RS12370 (NSQ16_12370) comGE 2409764..2410111 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=963663 NSQ16_RS12325 WP_003230187.1 2405289..2405462(+) (sinI) [Bacillus sp. PS108]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=963663 NSQ16_RS12325 WP_003230187.1 2405289..2405462(+) (sinI) [Bacillus sp. PS108]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1