Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WMC18_RS16070 Genome accession   NZ_CP150130
Coordinates   3180206..3180346 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SEC-482     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3175206..3185346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WMC18_RS16045 (WMC18_16010) - 3175552..3175935 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  WMC18_RS16050 (WMC18_16015) comA 3175957..3176601 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  WMC18_RS16055 (WMC18_16020) comP 3176682..3178982 (-) 2301 WP_406842664.1 histidine kinase Regulator
  WMC18_RS16060 (WMC18_16025) comX 3178996..3179169 (-) 174 WP_012118314.1 competence pheromone ComX -
  WMC18_RS16065 (WMC18_16030) - 3179138..3179998 (-) 861 WP_159073777.1 polyprenyl synthetase family protein -
  WMC18_RS16070 (WMC18_16035) degQ 3180206..3180346 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  WMC18_RS16075 (WMC18_16040) - 3180812..3181153 (+) 342 WP_014305721.1 hypothetical protein -
  WMC18_RS16080 (WMC18_16045) - 3181160..3182380 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  WMC18_RS16085 (WMC18_16050) - 3182510..3183976 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  WMC18_RS16090 (WMC18_16055) - 3183994..3184545 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  WMC18_RS16095 (WMC18_16060) - 3184642..3185040 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=963075 WMC18_RS16070 WP_003152043.1 3180206..3180346(-) (degQ) [Bacillus velezensis strain SEC-482]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=963075 WMC18_RS16070 WP_003152043.1 3180206..3180346(-) (degQ) [Bacillus velezensis strain SEC-482]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891