Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WMC18_RS12730 Genome accession   NZ_CP150130
Coordinates   2568706..2568879 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain SEC-482     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2563706..2573879
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WMC18_RS12715 (WMC18_12710) gcvT 2564524..2565624 (-) 1101 WP_003153108.1 glycine cleavage system aminomethyltransferase GcvT -
  WMC18_RS12720 (WMC18_12715) - 2566047..2567717 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  WMC18_RS12725 (WMC18_12720) - 2567735..2568529 (+) 795 WP_014305407.1 YqhG family protein -
  WMC18_RS12730 (WMC18_12725) sinI 2568706..2568879 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  WMC18_RS12735 (WMC18_12730) sinR 2568913..2569248 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WMC18_RS12740 (WMC18_12735) tasA 2569296..2570081 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  WMC18_RS12745 (WMC18_12740) sipW 2570145..2570729 (-) 585 WP_025852917.1 signal peptidase I SipW -
  WMC18_RS12750 (WMC18_12745) tapA 2570701..2571372 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  WMC18_RS12755 (WMC18_12750) - 2571631..2571960 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  WMC18_RS12760 (WMC18_12755) - 2572000..2572179 (-) 180 WP_003153093.1 YqzE family protein -
  WMC18_RS12765 (WMC18_12760) comGG 2572236..2572613 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  WMC18_RS12770 (WMC18_12765) comGF 2572614..2573114 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  WMC18_RS12775 (WMC18_12770) comGE 2573023..2573337 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  WMC18_RS12780 (WMC18_12775) comGD 2573321..2573758 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=963053 WMC18_RS12730 WP_003153105.1 2568706..2568879(+) (sinI) [Bacillus velezensis strain SEC-482]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=963053 WMC18_RS12730 WP_003153105.1 2568706..2568879(+) (sinI) [Bacillus velezensis strain SEC-482]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702