Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   WMC18_RS12775 Genome accession   NZ_CP150130
Coordinates   2573023..2573337 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain SEC-482     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2568023..2578337
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WMC18_RS12730 (WMC18_12725) sinI 2568706..2568879 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  WMC18_RS12735 (WMC18_12730) sinR 2568913..2569248 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WMC18_RS12740 (WMC18_12735) tasA 2569296..2570081 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  WMC18_RS12745 (WMC18_12740) sipW 2570145..2570729 (-) 585 WP_025852917.1 signal peptidase I SipW -
  WMC18_RS12750 (WMC18_12745) tapA 2570701..2571372 (-) 672 WP_014305409.1 amyloid fiber anchoring/assembly protein TapA -
  WMC18_RS12755 (WMC18_12750) - 2571631..2571960 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  WMC18_RS12760 (WMC18_12755) - 2572000..2572179 (-) 180 WP_003153093.1 YqzE family protein -
  WMC18_RS12765 (WMC18_12760) comGG 2572236..2572613 (-) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  WMC18_RS12770 (WMC18_12765) comGF 2572614..2573114 (-) 501 WP_226565836.1 competence type IV pilus minor pilin ComGF -
  WMC18_RS12775 (WMC18_12770) comGE 2573023..2573337 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  WMC18_RS12780 (WMC18_12775) comGD 2573321..2573758 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  WMC18_RS12785 (WMC18_12780) comGC 2573748..2574056 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  WMC18_RS12790 (WMC18_12785) comGB 2574061..2575098 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  WMC18_RS12795 (WMC18_12790) comGA 2575085..2576155 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  WMC18_RS12800 (WMC18_12795) - 2576347..2577297 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=963056 WMC18_RS12775 WP_015388003.1 2573023..2573337(-) (comGE) [Bacillus velezensis strain SEC-482]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=963056 WMC18_RS12775 WP_015388003.1 2573023..2573337(-) (comGE) [Bacillus velezensis strain SEC-482]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGTCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481