Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AABA16_RS02530 Genome accession   NZ_AP028610
Coordinates   494520..494669 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain Sep5     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 489520..499669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABA16_RS02480 (TKY124516_04830) blpI 490432..490629 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  AABA16_RS02485 (TKY124516_04850) blpJ 491095..491364 (+) 270 WP_001093249.1 bacteriocin-like peptide BlpJ -
  AABA16_RS02490 cipB 491433..491567 (+) 135 WP_128903586.1 bacteriocin class II family protein Regulator
  AABA16_RS02495 (TKY124516_04860) - 491504..491662 (+) 159 WP_001849862.1 hypothetical protein -
  AABA16_RS02500 - 491665..491784 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  AABA16_RS02505 (TKY124516_04870) - 492081..492245 (+) 165 WP_000727118.1 hypothetical protein -
  AABA16_RS02510 (TKY124516_04880) - 492242..492646 (+) 405 WP_000846943.1 hypothetical protein -
  AABA16_RS02515 - 492849..493653 (+) 805 WP_128903587.1 IS5 family transposase -
  AABA16_RS02520 (TKY124516_04910) blpM 493803..494057 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AABA16_RS02525 (TKY124516_04920) blpN 494073..494276 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AABA16_RS02530 (TKY124516_04930) cipB 494520..494669 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  AABA16_RS02535 - 494773..494892 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AABA16_RS02540 (TKY124516_04950) - 495678..496061 (+) 384 WP_000877381.1 hypothetical protein -
  AABA16_RS02545 (TKY124516_04960) - 496113..496802 (+) 690 WP_000760529.1 CPBP family intramembrane glutamic endopeptidase -
  AABA16_RS02550 (TKY124516_04970) blpZ 496844..497077 (+) 234 WP_001849865.1 immunity protein BlpZ -
  AABA16_RS02555 - 497228..497839 (+) 612 WP_000394037.1 type II CAAX endopeptidase family protein -
  AABA16_RS02560 (TKY124516_04980) - 498000..498794 (+) 795 WP_000363010.1 phosphotransferase family protein -
  AABA16_RS02565 (TKY124516_04990) trmB 498791..499426 (+) 636 WP_001266078.1 tRNA (guanosine(46)-N7)-methyltransferase TrmB -

Sequence


Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=96057 AABA16_RS02530 WP_001818346.1 494520..494669(+) (cipB) [Streptococcus pneumoniae strain Sep5]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=96057 AABA16_RS02530 WP_001818346.1 494520..494669(+) (cipB) [Streptococcus pneumoniae strain Sep5]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51


Multiple sequence alignment