Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   AABA16_RS02490 Genome accession   NZ_AP028610
Coordinates   491433..491567 (+) Length   44 a.a.
NCBI ID   WP_128903586.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain Sep5     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 486433..496567
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  AABA16_RS02470 (TKY124516_04810) - 486626..487987 (-) 1362 WP_001069067.1 bacteriocin secretion accessory protein -
  AABA16_RS02475 (TKY124516_04820) comA/nlmT 487998..490151 (-) 2154 WP_000205168.1 peptide cleavage/export ABC transporter BlpA Regulator
  AABA16_RS02480 (TKY124516_04830) blpI 490432..490629 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  AABA16_RS02485 (TKY124516_04850) blpJ 491095..491364 (+) 270 WP_001093249.1 bacteriocin-like peptide BlpJ -
  AABA16_RS02490 cipB 491433..491567 (+) 135 WP_128903586.1 bacteriocin class II family protein Regulator
  AABA16_RS02495 (TKY124516_04860) - 491504..491662 (+) 159 WP_001849862.1 hypothetical protein -
  AABA16_RS02500 - 491665..491784 (+) 120 WP_000346298.1 PncF family bacteriocin immunity protein -
  AABA16_RS02505 (TKY124516_04870) - 492081..492245 (+) 165 WP_000727118.1 hypothetical protein -
  AABA16_RS02510 (TKY124516_04880) - 492242..492646 (+) 405 WP_000846943.1 hypothetical protein -
  AABA16_RS02515 - 492849..493653 (+) 805 WP_128903587.1 IS5 family transposase -
  AABA16_RS02520 (TKY124516_04910) blpM 493803..494057 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  AABA16_RS02525 (TKY124516_04920) blpN 494073..494276 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  AABA16_RS02530 (TKY124516_04930) cipB 494520..494669 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  AABA16_RS02535 - 494773..494892 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  AABA16_RS02540 (TKY124516_04950) - 495678..496061 (+) 384 WP_000877381.1 hypothetical protein -

Sequence


Protein


Download         Length: 44 a.a.        Molecular weight: 5055.79 Da        Isoelectric Point: 3.6910

>NTDB_id=96056 AABA16_RS02490 WP_128903586.1 491433..491567(+) (cipB) [Streptococcus pneumoniae strain Sep5]
MDTKMMSQFSVMDTEMLACVEGGGCNWEILPKQVLEEQQQEVFN

Nucleotide


Download         Length: 135 bp        

>NTDB_id=96056 AABA16_RS02490 WP_128903586.1 491433..491567(+) (cipB) [Streptococcus pneumoniae strain Sep5]
ATGGATACAAAAATGATGTCACAATTTTCTGTTATGGATACTGAAATGCTTGCTTGCGTTGAAGGTGGCGGATGCAATTG
GGAGATTTTGCCAAAGCAGGTGTTGGAGGAGCAGCAGCAAGAGGTCTTCAACTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

43.59

88.636

0.386


Multiple sequence alignment