Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WKI55_RS12515 Genome accession   NZ_CP149651
Coordinates   2475218..2475391 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain MJ01     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2470218..2480391
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI55_RS12500 (WKI55_12500) gcvT 2471031..2472131 (-) 1101 WP_061890721.1 glycine cleavage system aminomethyltransferase GcvT -
  WKI55_RS12505 (WKI55_12505) - 2472555..2474225 (+) 1671 WP_257988702.1 DEAD/DEAH box helicase -
  WKI55_RS12510 (WKI55_12510) - 2474247..2475041 (+) 795 WP_014305407.1 YqhG family protein -
  WKI55_RS12515 (WKI55_12515) sinI 2475218..2475391 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI55_RS12520 (WKI55_12520) sinR 2475425..2475760 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI55_RS12525 (WKI55_12525) - 2475808..2476593 (-) 786 WP_017418136.1 TasA family protein -
  WKI55_RS12530 (WKI55_12530) - 2476658..2477242 (-) 585 WP_012117977.1 signal peptidase I -
  WKI55_RS12535 (WKI55_12535) tapA 2477214..2477885 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  WKI55_RS12540 (WKI55_12540) - 2478144..2478473 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI55_RS12545 (WKI55_12545) - 2478514..2478693 (-) 180 WP_003153093.1 YqzE family protein -
  WKI55_RS12550 (WKI55_12550) comGG 2478750..2479127 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI55_RS12555 (WKI55_12555) comGF 2479128..2479523 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI55_RS12560 (WKI55_12560) comGE 2479537..2479851 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI55_RS12565 (WKI55_12565) comGD 2479835..2480272 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=960425 WKI55_RS12515 WP_014418369.1 2475218..2475391(+) (sinI) [Bacillus velezensis strain MJ01]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=960425 WKI55_RS12515 WP_014418369.1 2475218..2475391(+) (sinI) [Bacillus velezensis strain MJ01]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719