Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   WKI55_RS12560 Genome accession   NZ_CP149651
Coordinates   2479537..2479851 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain MJ01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2474537..2484851
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI55_RS12515 (WKI55_12515) sinI 2475218..2475391 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI55_RS12520 (WKI55_12520) sinR 2475425..2475760 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI55_RS12525 (WKI55_12525) - 2475808..2476593 (-) 786 WP_017418136.1 TasA family protein -
  WKI55_RS12530 (WKI55_12530) - 2476658..2477242 (-) 585 WP_012117977.1 signal peptidase I -
  WKI55_RS12535 (WKI55_12535) tapA 2477214..2477885 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  WKI55_RS12540 (WKI55_12540) - 2478144..2478473 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI55_RS12545 (WKI55_12545) - 2478514..2478693 (-) 180 WP_003153093.1 YqzE family protein -
  WKI55_RS12550 (WKI55_12550) comGG 2478750..2479127 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI55_RS12555 (WKI55_12555) comGF 2479128..2479523 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI55_RS12560 (WKI55_12560) comGE 2479537..2479851 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI55_RS12565 (WKI55_12565) comGD 2479835..2480272 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  WKI55_RS12570 (WKI55_12570) comGC 2480262..2480570 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  WKI55_RS12575 (WKI55_12575) comGB 2480575..2481612 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  WKI55_RS12580 (WKI55_12580) comGA 2481599..2482669 (-) 1071 WP_106067891.1 competence type IV pilus ATPase ComGA Machinery gene
  WKI55_RS12585 (WKI55_12585) - 2482861..2483811 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=960428 WKI55_RS12560 WP_017418140.1 2479537..2479851(-) (comGE) [Bacillus velezensis strain MJ01]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=960428 WKI55_RS12560 WP_017418140.1 2479537..2479851(-) (comGE) [Bacillus velezensis strain MJ01]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481