Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WKI56_RS15555 Genome accession   NZ_CP149650
Coordinates   3067573..3067713 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain MJ02     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3062573..3072713
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI56_RS15530 (WKI56_15530) - 3062870..3063253 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  WKI56_RS15535 (WKI56_15535) comA 3063275..3063919 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  WKI56_RS15540 (WKI56_15540) comP 3064000..3066303 (-) 2304 WP_339078386.1 histidine kinase Regulator
  WKI56_RS15545 (WKI56_15545) comX 3066323..3066502 (-) 180 WP_318010531.1 competence pheromone ComX -
  WKI56_RS15550 (WKI56_15550) comQ 3066456..3067442 (-) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  WKI56_RS15555 (WKI56_15555) degQ 3067573..3067713 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  WKI56_RS15560 (WKI56_15560) - 3068178..3068519 (+) 342 WP_014418765.1 hypothetical protein -
  WKI56_RS15565 (WKI56_15565) - 3068526..3069749 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  WKI56_RS15570 (WKI56_15570) - 3069879..3071345 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  WKI56_RS15575 (WKI56_15575) - 3071363..3071914 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  WKI56_RS15580 (WKI56_15580) - 3072011..3072409 (-) 399 WP_087634936.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=960376 WKI56_RS15555 WP_003152043.1 3067573..3067713(-) (degQ) [Bacillus velezensis strain MJ02]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=960376 WKI56_RS15555 WP_003152043.1 3067573..3067713(-) (degQ) [Bacillus velezensis strain MJ02]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891