Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WKI56_RS11875 Genome accession   NZ_CP149650
Coordinates   2401594..2401767 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain MJ02     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2396594..2406767
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI56_RS11860 (WKI56_11860) gcvT 2397407..2398507 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  WKI56_RS11865 (WKI56_11865) - 2398931..2400601 (+) 1671 WP_021494309.1 SNF2-related protein -
  WKI56_RS11870 (WKI56_11870) - 2400623..2401417 (+) 795 WP_014418368.1 YqhG family protein -
  WKI56_RS11875 (WKI56_11875) sinI 2401594..2401767 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI56_RS11880 (WKI56_11880) sinR 2401801..2402136 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI56_RS11885 (WKI56_11885) - 2402184..2402969 (-) 786 WP_017418136.1 TasA family protein -
  WKI56_RS11890 (WKI56_11890) - 2403034..2403618 (-) 585 WP_014418370.1 signal peptidase I -
  WKI56_RS11895 (WKI56_11895) tapA 2403590..2404261 (-) 672 WP_339078352.1 amyloid fiber anchoring/assembly protein TapA -
  WKI56_RS11900 (WKI56_11900) - 2404520..2404849 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI56_RS11905 (WKI56_11905) - 2404890..2405069 (-) 180 WP_003153093.1 YqzE family protein -
  WKI56_RS11910 (WKI56_11910) comGG 2405126..2405503 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI56_RS11915 (WKI56_11915) comGF 2405504..2405899 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI56_RS11920 (WKI56_11920) comGE 2405913..2406227 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI56_RS11925 (WKI56_11925) comGD 2406211..2406648 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=960354 WKI56_RS11875 WP_014418369.1 2401594..2401767(+) (sinI) [Bacillus velezensis strain MJ02]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=960354 WKI56_RS11875 WP_014418369.1 2401594..2401767(+) (sinI) [Bacillus velezensis strain MJ02]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719