Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   WKI56_RS11920 Genome accession   NZ_CP149650
Coordinates   2405913..2406227 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain MJ02     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2400913..2411227
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI56_RS11875 (WKI56_11875) sinI 2401594..2401767 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI56_RS11880 (WKI56_11880) sinR 2401801..2402136 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI56_RS11885 (WKI56_11885) - 2402184..2402969 (-) 786 WP_017418136.1 TasA family protein -
  WKI56_RS11890 (WKI56_11890) - 2403034..2403618 (-) 585 WP_014418370.1 signal peptidase I -
  WKI56_RS11895 (WKI56_11895) tapA 2403590..2404261 (-) 672 WP_339078352.1 amyloid fiber anchoring/assembly protein TapA -
  WKI56_RS11900 (WKI56_11900) - 2404520..2404849 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI56_RS11905 (WKI56_11905) - 2404890..2405069 (-) 180 WP_003153093.1 YqzE family protein -
  WKI56_RS11910 (WKI56_11910) comGG 2405126..2405503 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI56_RS11915 (WKI56_11915) comGF 2405504..2405899 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI56_RS11920 (WKI56_11920) comGE 2405913..2406227 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI56_RS11925 (WKI56_11925) comGD 2406211..2406648 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  WKI56_RS11930 (WKI56_11930) comGC 2406638..2406946 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  WKI56_RS11935 (WKI56_11935) comGB 2406951..2407988 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  WKI56_RS11940 (WKI56_11940) comGA 2407975..2409045 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  WKI56_RS11945 (WKI56_11945) - 2409238..2410188 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=960357 WKI56_RS11920 WP_017418140.1 2405913..2406227(-) (comGE) [Bacillus velezensis strain MJ02]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=960357 WKI56_RS11920 WP_017418140.1 2405913..2406227(-) (comGE) [Bacillus velezensis strain MJ02]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481