Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WKI54_RS02200 Genome accession   NZ_CP149648
Coordinates   413257..413397 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain MJ04     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 408257..418397
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI54_RS02175 (WKI54_02175) - 408584..408967 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  WKI54_RS02180 (WKI54_02180) comA 408989..409633 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  WKI54_RS02185 (WKI54_02185) comP 409714..412020 (-) 2307 WP_017419423.1 sensor histidine kinase Regulator
  WKI54_RS02190 (WKI54_02190) comX 412039..412215 (-) 177 WP_017419424.1 competence pheromone ComX -
  WKI54_RS02195 (WKI54_02195) - 412230..413126 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  WKI54_RS02200 (WKI54_02200) degQ 413257..413397 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  WKI54_RS02205 (WKI54_02205) - 413862..414203 (+) 342 WP_110085235.1 hypothetical protein -
  WKI54_RS02210 (WKI54_02210) - 414210..415433 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  WKI54_RS02215 (WKI54_02215) - 415563..417029 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  WKI54_RS02220 (WKI54_02220) - 417047..417598 (-) 552 WP_017419426.1 isochorismatase family cysteine hydrolase -
  WKI54_RS02225 (WKI54_02225) - 417695..418093 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=960253 WKI54_RS02200 WP_003152043.1 413257..413397(-) (degQ) [Bacillus velezensis strain MJ04]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=960253 WKI54_RS02200 WP_003152043.1 413257..413397(-) (degQ) [Bacillus velezensis strain MJ04]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891