Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WDR05_RS12765 Genome accession   NZ_CP149444
Coordinates   2460464..2460847 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain HC-9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2455464..2465847
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WDR05_RS12725 (WDR05_12715) sinI 2456397..2456570 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  WDR05_RS12730 (WDR05_12720) sinR 2456604..2456939 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WDR05_RS12735 (WDR05_12725) tasA 2457032..2457817 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  WDR05_RS12740 (WDR05_12730) sipW 2457881..2458453 (-) 573 WP_072692741.1 signal peptidase I SipW -
  WDR05_RS12745 (WDR05_12735) tapA 2458437..2459198 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  WDR05_RS12750 (WDR05_12740) yqzG 2459470..2459796 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WDR05_RS12755 (WDR05_12745) spoIITA 2459838..2460017 (-) 180 WP_029726723.1 YqzE family protein -
  WDR05_RS12760 (WDR05_12750) comGG 2460089..2460463 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  WDR05_RS12765 (WDR05_12755) comGF 2460464..2460847 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  WDR05_RS12770 (WDR05_12760) comGE 2460873..2461220 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  WDR05_RS12775 (WDR05_12765) comGD 2461204..2461635 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  WDR05_RS12780 (WDR05_12770) comGC 2461625..2461921 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  WDR05_RS12785 (WDR05_12775) comGB 2461935..2462972 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  WDR05_RS12790 (WDR05_12780) comGA 2462959..2464029 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WDR05_RS12795 (WDR05_12785) - 2464242..2464439 (-) 198 WP_029726717.1 hypothetical protein -
  WDR05_RS12800 (WDR05_12790) corA 2464441..2465394 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=959126 WDR05_RS12765 WP_029726721.1 2460464..2460847(-) (comGF) [Bacillus subtilis strain HC-9]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=959126 WDR05_RS12765 WP_029726721.1 2460464..2460847(-) (comGF) [Bacillus subtilis strain HC-9]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969