Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WDR05_RS12725 Genome accession   NZ_CP149444
Coordinates   2456397..2456570 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain HC-9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2451397..2461570
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WDR05_RS12710 (WDR05_12700) gcvT 2452197..2453285 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  WDR05_RS12715 (WDR05_12705) hepAA 2453726..2455399 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  WDR05_RS12720 (WDR05_12710) yqhG 2455420..2456214 (+) 795 WP_015714249.1 YqhG family protein -
  WDR05_RS12725 (WDR05_12715) sinI 2456397..2456570 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  WDR05_RS12730 (WDR05_12720) sinR 2456604..2456939 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WDR05_RS12735 (WDR05_12725) tasA 2457032..2457817 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  WDR05_RS12740 (WDR05_12730) sipW 2457881..2458453 (-) 573 WP_072692741.1 signal peptidase I SipW -
  WDR05_RS12745 (WDR05_12735) tapA 2458437..2459198 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  WDR05_RS12750 (WDR05_12740) yqzG 2459470..2459796 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WDR05_RS12755 (WDR05_12745) spoIITA 2459838..2460017 (-) 180 WP_029726723.1 YqzE family protein -
  WDR05_RS12760 (WDR05_12750) comGG 2460089..2460463 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  WDR05_RS12765 (WDR05_12755) comGF 2460464..2460847 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  WDR05_RS12770 (WDR05_12760) comGE 2460873..2461220 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=959123 WDR05_RS12725 WP_003230187.1 2456397..2456570(+) (sinI) [Bacillus subtilis strain HC-9]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=959123 WDR05_RS12725 WP_003230187.1 2456397..2456570(+) (sinI) [Bacillus subtilis strain HC-9]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1