Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ACF2JY_RS08245 Genome accession   NZ_CP172966
Coordinates   1555980..1556153 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain cel     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 1550980..1561153
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ACF2JY_RS08200 (ACF2JY_08200) comGE 1551330..1551677 (+) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  ACF2JY_RS08205 (ACF2JY_08205) comGF 1551703..1552086 (+) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  ACF2JY_RS08210 (ACF2JY_08210) comGG 1552087..1552461 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  ACF2JY_RS08215 (ACF2JY_08215) spoIITA 1552533..1552712 (+) 180 WP_029726723.1 YqzE family protein -
  ACF2JY_RS08220 (ACF2JY_08220) yqzG 1552754..1553080 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  ACF2JY_RS08225 (ACF2JY_08225) tapA 1553352..1554113 (+) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  ACF2JY_RS08230 (ACF2JY_08230) sipW 1554097..1554669 (+) 573 WP_003230181.1 signal peptidase I SipW -
  ACF2JY_RS08235 (ACF2JY_08235) tasA 1554733..1555518 (+) 786 WP_014664586.1 biofilm matrix protein TasA -
  ACF2JY_RS08240 (ACF2JY_08240) sinR 1555611..1555946 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ACF2JY_RS08245 (ACF2JY_08245) sinI 1555980..1556153 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  ACF2JY_RS08250 (ACF2JY_08250) yqhG 1556336..1557130 (-) 795 WP_003230200.1 YqhG family protein -
  ACF2JY_RS08255 (ACF2JY_08255) hepAA 1557151..1558824 (-) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  ACF2JY_RS08260 (ACF2JY_08260) gcvT 1559266..1560354 (+) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=956115 ACF2JY_RS08245 WP_003230187.1 1555980..1556153(-) (sinI) [Bacillus subtilis strain cel]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=956115 ACF2JY_RS08245 WP_003230187.1 1555980..1556153(-) (sinI) [Bacillus subtilis strain cel]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1