Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   WG927_RS12400 Genome accession   NZ_CP148896
Coordinates   2545716..2546030 (-) Length   104 a.a.
NCBI ID   WP_029973875.1    Uniprot ID   -
Organism   Bacillus velezensis strain XS142     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2540716..2551030
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WG927_RS12355 (WG927_12340) sinI 2541397..2541570 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  WG927_RS12360 (WG927_12345) sinR 2541604..2541939 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WG927_RS12365 (WG927_12350) tasA 2541987..2542772 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  WG927_RS12370 (WG927_12355) sipW 2542837..2543421 (-) 585 WP_012117977.1 signal peptidase I SipW -
  WG927_RS12375 (WG927_12360) tapA 2543393..2544064 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  WG927_RS12380 (WG927_12365) - 2544323..2544652 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WG927_RS12385 (WG927_12370) - 2544693..2544872 (-) 180 WP_003153093.1 YqzE family protein -
  WG927_RS12390 (WG927_12375) comGG 2544929..2545306 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WG927_RS12395 (WG927_12380) comGF 2545307..2545702 (-) 396 WP_050569584.1 competence type IV pilus minor pilin ComGF -
  WG927_RS12400 (WG927_12385) comGE 2545716..2546030 (-) 315 WP_029973875.1 competence type IV pilus minor pilin ComGE Machinery gene
  WG927_RS12405 (WG927_12390) comGD 2546014..2546451 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  WG927_RS12410 (WG927_12395) comGC 2546441..2546749 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  WG927_RS12415 (WG927_12400) comGB 2546754..2547791 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  WG927_RS12420 (WG927_12405) comGA 2547778..2548848 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  WG927_RS12425 (WG927_12410) - 2549041..2549991 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11862.88 Da        Isoelectric Point: 6.9470

>NTDB_id=956031 WG927_RS12400 WP_029973875.1 2545716..2546030(-) (comGE) [Bacillus velezensis strain XS142]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMMTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=956031 WG927_RS12400 WP_029973875.1 2545716..2546030(-) (comGE) [Bacillus velezensis strain XS142]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGATGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

44.348

100

0.49